PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g23200.1
Common NameB1040D06.24, Os09g0395300, RL9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 533aa    MW: 54267.3 Da    PI: 9.4739
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g23200.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.6e-32325378255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  LOC_Os09g23200.1 325 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 378
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-15322379IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28323379IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23325378IPR006447Myb domain, plants
PfamPF002491.0E-6326377IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MAMVRELELM TSWSNSMGRH RYPTRILVDS FGHKCSASDK GVWTSCSIRA PLQGRGSFRR  60
GANIRFGSLP SSAAVATSGG GRGGGGVVVG GGGGDPWRRL DGSTASTELS LSPPPAQAAG  120
GGGGGGGADA LPWRHRPSPP SSAVATTSAA AAAALMAPMM LQPLDAGGGA SAPPPPIRGI  180
PIYNGPGGFP FLQPSPTAGD VGHHHHHHPK MGFYSSYHHP STWPSTSPSP LAAPPGAASS  240
PLDPTAAFLS SPHHRMLSAA SGRLNGMLSV SDTLRSYGVP GAAAPGVIGG AHHHHHHLHG  300
GQPFVGALAS RFMPKLPAKR SMRAPRMRWT STLHARFVHA VELLGGHERA TPKSVLELMD  360
VKDLTLAHVK SHLQMYRTVK STDKPAASSG PADGGSGDEE FAGGGQAASG GGDSMCLRGG  420
GGGGVAAAAF AEHGRSASEG AASSVGGGGG GDMDQSSAGN TSTTRWSNSS RDPWLSSNSC  480
NMDAHRSVGL SSPIENLEPC RSSSSQVSNH ELSSPSLEFT LGRPDWHGAD HD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17985GGRGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.55970.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154790060.0
Expression AtlasQ0J235-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and flowers. {ECO:0000269|PubMed:18594992}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g23200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Rolled inward leaves like a cylinder at mature stage. Malformed spikelets with low seed sets. Slight delay in heading date. Disordered and irregular arrangement of chloroplast grana lamellae. {ECO:0000269|PubMed:18594992}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g23200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ2687480.0FJ268748.1 Oryza sativa Japonica Group rolled leaf 9 (RL9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610960.10.0PREDICTED: probable transcription factor RL9
SwissprotQ0J2350.0ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0E0QR190.0A0A0E0QR19_ORYRU; Uncharacterized protein
STRINGLOC_Os09g23200.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-42G2-like family protein
Publications ? help Back to Top
  1. Yan S, et al.
    ROLLED LEAF 9, encoding a GARP protein, regulates the leaf abaxial cell fate in rice.
    Plant Mol. Biol., 2008. 68(3): p. 239-50
    [PMID:18594992]