PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g19950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 363aa    MW: 37637.6 Da    PI: 5.2887
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g19950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.58.3e-37721711100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCaaCk++rrkC++dC+la+yfpa+++++f n+h+lFG+s+++k+l+++p+e + dam++l++eA+ara+dPv Ga++v+ +l +q+e l+ae
  LOC_Os09g19950.1  72 ACAACKYQRRKCNADCPLARYFPADEQRRFLNAHHLFGVSKIQKTLRDTPPELHADAMQALTFEANARASDPVGGAARVVVELCRQYEMLHAE 164
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la+++++
  LOC_Os09g19950.1 165 LAAVQHH 171
                       ****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.7971172IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3372169IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MTASSSTTNS SSSVSTADTS SSNPPPQHAL HRQHIASSSA SSGGGGAAAP LPPRAPPRVG  60
GGGGGGVGQS QACAACKYQR RKCNADCPLA RYFPADEQRR FLNAHHLFGV SKIQKTLRDT  120
PPELHADAMQ ALTFEANARA SDPVGGAARV VVELCRQYEM LHAELAAVQH HLKLCRQQHA  180
AAAAAAANDP LVANVDPLAD PAAEMLFAGA VVPNQNDDAM VDAFYADQQT AGDGDQEQYL  240
VKDEALAAQP PPQQPYEYLN YGTAGDEGSS HAWYTGNGGD ADASPPMGLS DQLQQCQIGA  300
APPFDVKPEL PATMEHGGSV FVEQPEQKIL PAAGSSSSAA AHCQLELGCS SNAWKVGTHV  360
IN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.531820.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329812560.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g19950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g19950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056750.0AP005675.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1001_G09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611163.10.0PREDICTED: LOB domain-containing protein 19, partial
TrEMBLA0A0E0QQE90.0A0A0E0QQE9_ORYRU; Uncharacterized protein
STRINGLOC_Os09g19950.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55241021
MonocotsOGMP182931010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.12e-25LOB domain-containing protein 7