PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g14040.1
Common NameP0450F09.19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 393aa    MW: 44836 Da    PI: 7.494
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g14040.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR127.51e-0841755590
              FAR1 55 raetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                       +etr++C+a++k++   dg + +++++ eHnH+la
  LOC_Os09g14040.1 41 WPETRCKCQACMKISII-DGLYSIYHFVPEHNHNLA 75
                      579**************.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-44275IPR004330FAR1 DNA binding domain
PfamPF105511.3E-26197291IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MPDELPIPGP MPSKLLNTGT YGSRGIDKRA EASGYGDSFS WPETRCKCQA CMKISIIDGL  60
YSIYHFVPEH NHNLATRSQA HQLRSQRKIN EAQIASVEVA KSVGISTKAA IDLMAKQACG  120
FENLGFTRVD MKNKLYSKRS LQTKQGDTGG VLEYMEKKAS EDVKFFYSIQ VDEDVLITNI  180
FWADSKMVAD YEDFGDVVCF DTTYRKLDDG HPFGLLVGVN NHKKTTVFGA ALLYDETANS  240
FVWLFNTFLN VISGKKPKTI LPNEDAAMAK AIKIVLPETH HRICVWHMNQ NACKHLTGCV  300
KDYKKFNADF QNCIYDQEEE EEFLRAWGQL LEKYELQQNT WLQRIFKKRE QWALVYGRNT  360
FSADTSTTRR NESLNNELKG YISVKYDMLT FF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.895880.0callus| flower| leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ69P28
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g14040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g14040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0055860.0AP005586.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0450F09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462721.11e-176hypothetical protein SORBIDRAFT_02g030865, partial
TrEMBLQ69P280.0Q69P28_ORYSJ; Putative far-red impaired response protein
STRINGLOC_Os09g14040.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-81FAR1-related sequence 5