PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g12770.2
Common NameLOC4346661, OJ1381_H04.36, Os09g0299200, OSJNBa0062A09.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 255aa    MW: 27732.8 Da    PI: 8.4722
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g12770.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.4e-342377155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      ++rlrWt+eLHerFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  LOC_Os09g12770.2 23 RQRLRWTNELHERFVEAVTQLGGPDRATPKGVLRIMGVQGLTIYHVKSHLQKYRL 77
                      58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7112080IPR017930Myb domain
SuperFamilySSF466893.76E-182277IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-322278IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-262478IPR006447Myb domain, plants
PfamPF002493.2E-92576IPR001005SANT/Myb domain
PfamPF143795.0E-23110155IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MELGGNNMGP DNGANNNSNL AARQRLRWTN ELHERFVEAV TQLGGPDRAT PKGVLRIMGV  60
QGLTIYHVKS HLQKYRLAKY IPDSSADGNK AENKDPGDLL AGLEGSSGLQ ISEALKLQME  120
VQKRLHEQLE VQRQLQLRIE AQGKYLKKII EEQQRLGGVK SETPAAGASV TLPSDQFPDS  180
ERTDPSTPAP TSESPTQGVP SNRDNGGQNE ATKSPQRDDS LSRHEPLTPD SNCQPGSPTA  240
SPKHERAAKR QRGH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.147190.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329884500.0
Expression AtlasQ69TN6-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g12770.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g12770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1032410.0AK103241.1 Oryza sativa Japonica Group cDNA clone:J033123H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611985.10.0PREDICTED: protein PHR1-LIKE 1 isoform X2
SwissprotQ8GUN53e-50PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0D3H4W90.0A0A0D3H4W9_9ORYZ; Uncharacterized protein
TrEMBLQ69TN60.0Q69TN6_ORYSJ; Os09g0299200 protein
TrEMBLA0A0E0QPE20.0A0A0E0QPE2_ORYRU; Uncharacterized protein
STRINGLOC_Os09g12770.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-78G2-like family protein