PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g12750.1
Common NameLOC4346660, OsJ_28761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 251aa    MW: 27332.2 Da    PI: 8.8171
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g12750.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.2e-333387155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprlrWt +LHerFv+av+qLGG+ekAtPktil++m+vkgLtl h+kSHLQkYRl
  LOC_Os09g12750.1 33 KPRLRWTADLHERFVDAVAQLGGPEKATPKTILRTMGVKGLTLFHLKSHLQKYRL 87
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7383090IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-313088IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-243388IPR006447Myb domain, plants
SuperFamilySSF466891.97E-163389IPR009057Homeodomain-like
PfamPF002491.5E-83586IPR001005SANT/Myb domain
PfamPF143791.2E-21128173IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MFPPGLIHHR PDGGEAGRAA GGGPSLVLTA DPKPRLRWTA DLHERFVDAV AQLGGPEKAT  60
PKTILRTMGV KGLTLFHLKS HLQKYRLGKQ SGKEASEQSK DASYLLDAQG GMSVSPRVST  120
QDVKENQEVK EALRAQMEMQ RRLHEQVEVQ KHVQIRMEAY QKYIDTLLEK ACKIVSEQLA  180
SSGFSISDND LPELSGGVMC GSADTLSSSI FHQLSVSPIN LHSPEGKPTP SGIEGQMILQ  240
KSPELKRKSC *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.64300.0callus| flower| leaf| panicle| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329793600.0
Expression AtlasB9G2Q6-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g12750.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g12750
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0693360.0AK069336.1 Oryza sativa Japonica Group cDNA clone:J023010K22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611986.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK52e-55APL_ARATH; Myb family transcription factor APL
TrEMBLB9G2Q60.0B9G2Q6_ORYSJ; Uncharacterized protein
TrEMBLA0A0D3H4W80.0A0A0D3H4W8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IHN20.0A0A0E0IHN2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QPE10.0A0A0E0QPE1_ORYRU; Uncharacterized protein
TrEMBLA0A0E0B1190.0A0A0E0B119_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0EQI60.0A0A0E0EQI6_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g12750.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP34273873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-72G2-like family protein