PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g06464.1
Common NameLOC4346474, Os09g0240200, OSNPB_090240200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 336aa    MW: 36082 Da    PI: 5.2724
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g06464.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.72.4e-081356441
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                      ++C+ + + +  ++C  ++  lC++C    H +       H++vp
  LOC_Os09g06464.1 13 QRCDSCRSAPCAFYCLADSAALCATCDADVH-SvnplarrHRRVP 56
                      79*****************************.4478888899887 PP

2CCT69.11.2e-23268311144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea++ RY+eKrktR+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  LOC_Os09g06464.1 268 REARVHRYREKRKTRRFEKTIRYASRKAYAETRPRIKGRFAKRS 311
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.2E-141057IPR000315B-box-type zinc finger
PfamPF006432.2E-61356IPR000315B-box-type zinc finger
CDDcd000213.76E-111457No hitNo description
PROSITE profilePS5011911.0211557IPR000315B-box-type zinc finger
PROSITE profilePS5101716.797268310IPR010402CCT domain
PfamPF062031.5E-17268310IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MLKLEPEFPG LPQRCDSCRS APCAFYCLAD SAALCATCDA DVHSVNPLAR RHRRVPMGVV  60
AAPGAGGAFV VRPAGGVNSS WPIREGRRCD YDDDDADAAG EEDEEATSWL LFDPLKDSSD  120
QGLPPFGDAL VADFLNLGGG AGEKEDASSS KDCSSSHGKS SEGSHEFAVP GEPVPERQGF  180
GAVSMDITDY DASNFRRGYS FGASLGHSVS MSSLENMSTV PDCGVPDITT SYLRSSKSTI  240
DLFTAAAGSP VAAHSIMSPP QFMGAIDREA RVHRYREKRK TRRFEKTIRY ASRKAYAETR  300
PRIKGRFAKR SDTDLEVDQY FSTTADSSCG VVPTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.33990.0flower| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1172293330.0
Expression AtlasO82117-
Function -- GeneRIF ? help Back to Top
  1. primarily controls flowering time under short day conditions by negatively regulating Hd3a and FTL expression
    [PMID: 18449564]
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g06464.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g06464
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0018870.0AB001887.1 Oryza sativa Japonica Group cDNA for zinc finger protein, complete cds, clone:S12569.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612389.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2 isoform X1
TrEMBLA0A0E0QNB10.0A0A0E0QNB1_ORYRU; Uncharacterized protein
TrEMBLO821170.0O82117_ORYSJ; Os09g0240200 protein
STRINGLOC_Os09g06464.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
MonocotsOGMP1435899
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-17CONSTANS-like 1
Publications ? help Back to Top
  1. Kim SK, et al.
    OsCO3, a CONSTANS-LIKE gene, controls flowering by negatively regulating the expression of FT-like genes under SD conditions in rice.
    Planta, 2008. 228(2): p. 355-65
    [PMID:18449564]
  2. Song J, et al.
    Isolation and mapping of a family of putative zinc-finger protein cDNAs from rice.
    DNA Res., 1998. 5(2): p. 95-101
    [PMID:9679197]