PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g01960.1
Common NameLOC4346379, Os09g0106700, OSNPB_090106700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 320aa    MW: 34573.3 Da    PI: 10.2107
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g01960.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181762147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEde l ++v ++G ++W++I++ ++ gR++k+c++rw + 
  LOC_Os09g01960.1 17 KGPWSPEEDEALQRLVGRHGARNWSLISKSIP-GRSGKSCRLRWCNQ 62
                      79******************************.***********985 PP

2Myb_DNA-binding52.79.6e-1771113347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  LOC_Os09g01960.1  71 PFTPEEDDTILRAHARFGNK-WATIARLLA-GRTDNAIKNHWNST 113
                       89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.1881267IPR017930Myb domain
SuperFamilySSF466891.05E-3114110IPR009057Homeodomain-like
SMARTSM007174.0E-161665IPR001005SANT/Myb domain
PfamPF002497.2E-181762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-261870IPR009057Homeodomain-like
CDDcd001671.45E-151961No hitNo description
SMARTSM007179.0E-1568116IPR001005SANT/Myb domain
PROSITE profilePS5129420.81469118IPR017930Myb domain
PfamPF002492.3E-1471113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2371117IPR009057Homeodomain-like
CDDcd001676.16E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MMASCRRGGG GDVDRIKGPW SPEEDEALQR LVGRHGARNW SLISKSIPGR SGKSCRLRWC  60
NQLSPQVEHR PFTPEEDDTI LRAHARFGNK WATIARLLAG RTDNAIKNHW NSTLKRKHHS  120
SLLADDLRPL KRTTSDGHPT LSSAAAPGSP SGSDLSDSSH HSLPSQMPSS PPHLLLPQHV  180
YRPVARAGGV VVPPPPPPPP PATSLSLSLS LPGLDHPHPD PSTPSEPAVQ LQPPPPSQMP  240
PPTPSCVRQE PPQMPFQLQP PPPPRPSAPF SAEFLAMMQE MIRIEVRNYM SGSAAVDPRS  300
SPDNGVRAAS RIMGMAKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-39141174107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.49450.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0J3I9
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00596DAPTransfer from AT5G67300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g01960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g01960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0058210.0AP005821.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OSJNBa0094B20.
GenBankAK0661410.0AK066141.1 Oryza sativa Japonica Group cDNA clone:J013055K23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612590.10.0PREDICTED: transcription factor MYB44
SwissprotQ9FDW12e-82MYB44_ARATH; Transcription factor MYB44
TrEMBLQ0J3I90.0Q0J3I9_ORYSJ; Os09g0106700 protein
STRINGLOC_Os09g01960.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-66myb domain protein r1