PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g44820.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 492aa    MW: 54219.4 Da    PI: 4.2201
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g44820.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.5e-53211481128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       l+pGfrFhPtdeelv++yLk+kv+g++l++ ++i+evd+ykvePwdLp+  ++++++++wyfFs+ d+k+a+  r+nrat+ gyWk+tgkd+e
  LOC_Os08g44820.3  21 LAPGFRFHPTDEELVSYYLKRKVHGRPLKV-DAIAEVDLYKVEPWDLPArsRLRSRDSQWYFFSRLDRKHANRARTNRATAGGYWKTTGKDRE 112
                       579***************************.99***************4357888999*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v + + ++vg+kktLvf+ grapkge+t+Wvmheyrl
  LOC_Os08g44820.3 113 VRN-GPTTVGMKKTLVFHAGRAPKGERTNWVMHEYRL 148
                       **9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-6014168IPR003441NAC domain
PROSITE profilePS5100558.61221168IPR003441NAC domain
PfamPF023654.1E-2923148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MSHPSSSSSS APPAAAEATS LAPGFRFHPT DEELVSYYLK RKVHGRPLKV DAIAEVDLYK  60
VEPWDLPARS RLRSRDSQWY FFSRLDRKHA NRARTNRATA GGYWKTTGKD REVRNGPTTV  120
GMKKTLVFHA GRAPKGERTN WVMHEYRLDG QTTIPPQDSF VVCRIFQKAG PGPQNGAQYG  180
APFVEEEWEE DDEDVGLLPV EEKDNSDDQE KEISGAMEKG YLQMSDLVQN LVDQNENGTI  240
ALPVSDNSNN SNHSEDVDGN SGDILSDQNL GSNFLHHVEP VEQNGLVLNE NMFSSANAGD  300
LFNISSPNDG FLELKDFADI ADLENPLANE STIWPSDGWP WKSTDSMEAV NGASNEFSPL  360
AGEQIFQPEE LEQLLQSLQE DSHMGSTISD PPHSSITNLA KPEEDCLMFY DAPFDSSMCD  420
DGFRQLNGFL GSPSTNLSGI DMVDDGMPYY DAMDDNLFND LLSSVQPSAG SSSHAFSGPV  480
LTQEIPRPRV V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-46161689168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.93540.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379903960.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g44820.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g44820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1207730.0AK120773.1 Oryza sativa Japonica Group cDNA clone:J023008J18, full insert sequence.
GenBankAK0996290.0AK099629.1 Oryza sativa Japonica Group cDNA clone:J013057D07, full insert sequence.
GenBankAK0697330.0AK069733.1 Oryza sativa Japonica Group cDNA clone:J023030H12, full insert sequence.
GenBankKF2802620.0KF280262.1 Oryza sativa Japonica Group NAC transcription factor (NAC40) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649510.10.0PREDICTED: uncharacterized protein LOC4346333
TrEMBLA0A0E0QMF50.0A0A0E0QMF5_ORYRU; Uncharacterized protein
STRINGBGIOSGA026481-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g44820.10.0(Oryza sativa Japonica Group)
STRINGORGLA08G0191600.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.17e-74NAC domain containing protein 53