PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g43600.1
Common NameLOC9272719, OJ1479_B11.14, Os08g0549600, OsJ_28195, OSNPB_080549600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 147aa    MW: 15433.1 Da    PI: 8.7343
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g43600.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.31.1e-1572127560
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                       +r rr++kNRe+A rsR+RK+a+++eLe++v  L aeN aL+ +  +lk  +a+ +
  LOC_Os08g43600.1  72 RRKRRAMKNRESAERSRARKQAYLQELEQEVRLLRAENAALRHQCHQLKAAAAEAE 127
                       699**********************************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-1168132IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.55370120IPR004827Basic-leucine zipper domain
CDDcd147076.57E-1672120No hitNo description
PfamPF001702.9E-1372122IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-1372125No hitNo description
SuperFamilySSF579592.95E-1172121No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MERAAGTGSG GDDDELVLPP ASFQDGLPSS RSYPSCIGGG SAAAASASLE RELLYRAELH  60
QQQLGGGGGV ERRKRRAMKN RESAERSRAR KQAYLQELEQ EVRLLRAENA ALRHQCHQLK  120
AAAAEAEAEA AAAAAAAKKP TSSATF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.783770.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6ZJI7
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g43600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g43600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8360230.0CT836023.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN045B18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649649.12e-98PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0E0IFI02e-98A0A0E0IFI0_ORYNI; Uncharacterized protein
TrEMBLQ6ZJI72e-98Q6ZJI7_ORYSJ; Os08g0549600 protein
STRINGLOC_Os08g43600.15e-98(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9528513
MonocotsOGMP151931719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.12e-08bZIP family protein