PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g42440.1
Common NameLOC4346162, Os08g0536300, OSJNBa0033D24.33, OSNPB_080536300, P0665C04.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 489aa    MW: 51863.8 Da    PI: 6.63
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g42440.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.81.6e-061455237
          zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                      +++ C+ ++e  + l+C+ +   lC  C  + H        H
  LOC_Os08g42440.1 14 QQWPCDYCGEAAAALHCRADAARLCVACDRHVHAAnalsrkH 55
                      7899*******9******************999545555555 PP

2CCT63.18.4e-22435478144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       R+ a++RY+eK+k+R++eK+irYesRK +A++R+RvKGrFvk++
  LOC_Os08g42440.1 435 RDSAMQRYREKKKNRRYEKHIRYESRKLRADTRKRVKGRFVKSN 478
                       899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.1E-111360IPR000315B-box-type zinc finger
PROSITE profilePS501199.8831360IPR000315B-box-type zinc finger
CDDcd000211.00E-81660No hitNo description
PfamPF062034.2E-16435477IPR010402CCT domain
PROSITE profilePS5101715.19435477IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MKDGGGGGGR GQQQQWPCDY CGEAAAALHC RADAARLCVA CDRHVHAANA LSRKHVRAPL  60
CAACAARPAA ARVASASAPA FLCADCDTGC GGDDGAALRV PVEGFSGCPA AAELAASWGL  120
DLPGGCGGEE EEADDAFFSA LDYSMLAVDP VLRDLYVPCD PPEVVVAGGG RRLKGEALGH  180
QLAEMARREA ETAHPHTQPH SDLSPRTPRR TSAAASGRLQ EKQAPPPLPH AAATAAPLPY  240
TSLLMMAPAN CTELMENNRV GDEDENVLWE STAPSVPPTQ IWDFNLGKSR DHNENSALEV  300
GFGSNNGGFM IKSYNDMLKE ISSGTTKDLE DIYDSRYFAA AEDIMSTNVC QLSSKNPSTR  360
SNKRKASSCA STIDGPTTST SHVPAASGAL GGSSNDRGSA LPKEISFCDQ TVVPTGADQR  420
PCTIKIDSET LAQNRDSAMQ RYREKKKNRR YEKHIRYESR KLRADTRKRV KGRFVKSNGA  480
PDDVSNGG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.255990.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329849310.0
Expression AtlasQ6Z1G2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g42440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g42440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0997220.0AK099722.1 Oryza sativa Japonica Group cDNA clone:J013088K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649825.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14
TrEMBLQ6Z1G20.0Q6Z1G2_ORYSJ; Os08g0536300 protein
STRINGLOC_Os08g42440.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5453813
MonocotsOGMP45042026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.29e-24B-box type zinc finger protein with CCT domain