PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g41960.1
Common NameLOC4346135, Os08g0531900, OSNPB_080531900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 184aa    MW: 20764.8 Da    PI: 10.1593
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g41960.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.14.1e-271766251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rie+ + rqv fskRr g++KKA+ELSvLCda+va+++fs+ g+lye++s
  LOC_Os08g41960.1 17 RIEDRTSRQVRFSKRRSGLFKKAYELSVLCDAQVALLVFSPAGRLYEFAS 66
                      8***********************************************86 PP

2K-box172.5e-071281704385
             K-box  43 LesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                       +++L++ eL+ Le+++ ++l+ +++k +  + + + ++ kk k
  LOC_Os08g41960.1 128 VNELNIAELRGLEEAMTNALTVVKNKLMMKVASVLPQSEKKRK 170
                       799********************99988777777777766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-35867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.291868IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-291086IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-281030IPR002100Transcription factor, MADS-box
CDDcd002651.24E-311378No hitNo description
PfamPF003193.0E-261764IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283045IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-284566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MEGGGRRRKR GKVELRRIED RTSRQVRFSK RRSGLFKKAY ELSVLCDAQV ALLVFSPAGR  60
LYEFASSTSS IDTIFGRYWD LLDTTIDLNI EARESRVDCN IQLRQKERSD DPVPKINHIT  120
QCVLESNVNE LNIAELRGLE EAMTNALTVV KNKLMMKVAS VLPQSEKKRK SCSISEPRSG  180
VSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-1710101384Myocyte-specific enhancer factor 2B
1tqe_Q1e-1710101384Myocyte-specific enhancer factor 2B
1tqe_R1e-1710101384Myocyte-specific enhancer factor 2B
1tqe_S1e-1710101384Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1512RRRKRGKV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.574190.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160123450.0
Expression AtlasA0A0P0XI85-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g41960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g41960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2429800.0AK242980.1 Oryza sativa Japonica Group cDNA, clone: J090094F15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649438.11e-132PREDICTED: agamous-like MADS-box protein AGL3 isoform X2
TrEMBLA0A0P0XI851e-132A0A0P0XI85_ORYSJ; Os08g0531900 protein
STRINGLOC_Os08g41960.11e-132(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.33e-28MIKC_MADS family protein