PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g41950.2
Common NameAGL6, LOC4346134, M79, MADS45, MADS7, Os08g0531700, P0702E04.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28713.7 Da    PI: 8.9742
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g41950.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  LOC_Os08g41950.2  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                      79***********************************************96 PP

2K-box97.42.1e-32841768100
             K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       + e+++ + +++e+ kLk+++enLqr+qR+llGedL+sL +keL++Le+qL++slk++R++++++l++q+ elq+ke++++e+n++Lr+klee
  LOC_Os08g41950.2  84 NRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEE 176
                       467888999*********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.389161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.30E-44277No hitNo description
SuperFamilySSF554555.76E-34289IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2486174IPR002487Transcription factor, K-box
PROSITE profilePS5129714.80490180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
QSMTKTLEKY QKCSYAGPET AVQNRESEQL KASRNEYLKL KARVENLQRT QRNLLGEDLD  120
SLGIKELESL EKQLDSSLKH VRTTRTKHLV DQLTELQRKE QMVSEANRCL RRKLEESNHV  180
RGQQVWEQGC NLIGYERQPE VQQPLHGGNG FFHPLDAAGE PTLQIGYPAE HHEAMNSACM  240
NTYMPPWLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-29751761103Developmental protein SEPALLATA 3
4ox0_B2e-29751761103Developmental protein SEPALLATA 3
4ox0_C2e-29751761103Developmental protein SEPALLATA 3
4ox0_D2e-29751761103Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.22360.0flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO453859630.0
Expression AtlasQ0J466-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) primordia and later in stamen and pistil primordia. Expressed during ovule development in the inner and outer integuments. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695}.
UniprotTISSUE SPECIFICITY: Expressed in lodicules, stamens and carpels. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695, ECO:0000269|PubMed:9339904}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.10}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g41950.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q0J466
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g41950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509340.0FJ750934.1 Oryza sativa clone KCS054B01 MADS-box transcription factor 7 mRNA, complete cds.
GenBankAK1002630.0AK100263.1 Oryza sativa Japonica Group cDNA clone:J023063L04, full insert sequence.
GenBankOSU788910.0U78891.2 Oryza sativa MADS box protein (MADS7) mRNA, complete cds.
GenBankOSU319940.0U31994.1 Oryza sativa MADS box protein OsMADS45 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648762.10.0PREDICTED: MADS-box transcription factor 7 isoform X2
SwissprotP0C5B00.0MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4660.0MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLD3U2G60.0D3U2G6_ORYSA; MADS-box transcription factor 7
TrEMBLI1QLJ90.0I1QLJ9_ORYGL; Uncharacterized protein
STRINGBGIOSGA029052-PA0.0(Oryza sativa Indica Group)
STRINGORGLA08G0230000.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.11e-92MIKC_MADS family protein
Publications ? help Back to Top
  1. Moon YH, et al.
    Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system.
    Plant Physiol., 1999. 120(4): p. 1193-204
    [PMID:10444103]
  2. Favaro R, et al.
    Ovule-specific MADS-box proteins have conserved protein-protein interactions in monocot and dicot plants.
    Mol. Genet. Genomics, 2002. 268(2): p. 152-9
    [PMID:12395189]
  3. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  4. Fornara F, et al.
    Functional characterization of OsMADS18, a member of the AP1/SQUA subfamily of MADS box genes.
    Plant Physiol., 2004. 135(4): p. 2207-19
    [PMID:15299121]
  5. Greco R, et al.
    MADS box genes expressed in developing inflorescences of rice and sorghum.
    Mol. Gen. Genet., 1997. 253(5): p. 615-23
    [PMID:9065695]
  6. Kang HG,Jang S,Chung JE,Cho YG,An G
    Characterization of two rice MADS box genes that control flowering time.
    Mol. Cells, 1997. 7(4): p. 559-66
    [PMID:9339904]