PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g41950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 311aa    MW: 36121.7 Da    PI: 10.1175
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g41950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.31.5e-313585151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  LOC_Os08g41950.1 35 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 85
                      79***********************************************96 PP

2K-box16.92.6e-07110140838
             K-box   8 sleeakaeslqqelakLkkeienLqreqRhl 38 
                       + e+++ + +++e+ kLk+++enLqr+qR++
  LOC_Os08g41950.1 110 NRESEQLKASRNEYLKLKARVENLQRTQRQY 140
                       467888999********************97 PP

3K-box74.52.9e-2516523728100
             K-box  28 ienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       +e+L    R+llGedL+sL +keL++Le+qL++slk++R++++++l++q+ elq+ke++++e+n++Lr+klee
  LOC_Os08g41950.1 165 TEKLCMYERNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEE 237
                       57889999**************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.3892787IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-412786IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.03E-3428115IPR002100Transcription factor, MADS-box
CDDcd002651.20E-4328103No hitNo description
PRINTSPR004041.5E-322949IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002983IPR002100Transcription factor, MADS-box
PfamPF003193.3E-263683IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-324964IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-326485IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.822116241IPR002487Transcription factor, K-box
PfamPF014863.4E-19165235IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAEKKKKKKK KKPQSLLVLT SWRSIGMGRG RVELKRIENK INRQVTFAKR RNGLLKKAYE  60
LSVLCDAEVA LIIFSNRGKL YEFCSTQSMT KTLEKYQKCS YAGPETAVQN RESEQLKASR  120
NEYLKLKARV ENLQRTQRQY YKSKHRLCLV RSKVWNLVKI RDDVTEKLCM YERNLLGEDL  180
DSLGIKELES LEKQLDSSLK HVRTTRTKHL VDQLTELQRK EQMVSEANRC LRRKLEESNH  240
VRGQQVWEQG CNLIGYERQP EVQQPLHGGN GFFHPLDAAG EPTLQIGYPA EHHEAMNSAC  300
MNTYMPPWLP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-221012371103Developmental protein SEPALLATA 3
4ox0_B3e-221012371103Developmental protein SEPALLATA 3
4ox0_C3e-221012371103Developmental protein SEPALLATA 3
4ox0_D3e-221012371103Developmental protein SEPALLATA 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212EKKKKKKKKKP
2311KKKKKKKKK
3511KKKKKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.22360.0flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO453859630.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g41950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g41950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519210.0AY551921.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS216 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648761.10.0PREDICTED: MADS-box transcription factor 7 isoform X1
SwissprotP0C5B00.0MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4660.0MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLA0A0E0IF020.0A0A0E0IF02_ORYNI; Uncharacterized protein
STRINGLOC_Os08g41950.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.19e-85MIKC_MADS family protein