PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g40260.1
Common NameLOC4346023, Os08g0513700, OsJ_026806, P0711H09.27, SPL15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 1141aa    MW: 124431 Da    PI: 7.6357
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g40260.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.7e-40186263178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +Cqv++C+adl++ak+yhrrhkvCe+h k++++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  LOC_Os08g40260.1 186 MCQVDDCRADLTNAKDYHRRHKVCEIHGKTTKALVGNQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 263
                       6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-34179248IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.949184261IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-37185264IPR004333Transcription factor, SBP-box
PfamPF031102.5E-29187260IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 1141 aa     Download sequence    Send to blast
MQREVGPQVA PPMFLHQIQP LPPHATAAKK RGNPWPAAAV AAAEAKGGGN WNPRMWDWDS  60
RALTAKPSSD ALRVNAGLSH HQQQQQQSPP AAAKAAEALR QGGGGSGGLN LQLGLREDAA  120
TPMDVSPAAT TVSSSPSPPA SSAPAQEPVV RPSKRVRSGS PGSASGGGGG GGGGGNSGGG  180
GGSYPMCQVD DCRADLTNAK DYHRRHKVCE IHGKTTKALV GNQMQRFCQQ CSRFHPLSEF  240
DEGKRSCRRR LAGHNRRRRK TQPTDVASQL LLPGNQENAA NRTQDIVNLI TVIARLQGSN  300
VGKLPSIPPI PDKDNLVQII SKINSINNGN SASKSPPSEA VDLNASHSQQ QDSVQRTTNG  360
FEKQTNGLDK QTNGFDKQAD GFDKQAVPST MDLLAVLSTA LATSNPDSNT SQSQGSSDSS  420
GNNKSKSQST EPANVVNSHE KSIRVFSATR KNDALERSPE MYKQPDQETP PYLSLRLFGS  480
TEEDVPCKMD TANKYLSSES SNPLDERSPS SSPPVTHKFF PIRSVDEDAR IADYGEDIAT  540
VEVSTSRAWR APPLELFKDS ERPIENGSPP NPAYQSCYTS TSCSDHSPST SNSDGQDRTG  600
RIIFKLFGKE PSTIPGNLRG EIVNWLKHSP NEMEGYIRPG CLVLSMYLSM PAIAWDELEE  660
NLLQRVNTLV QGSDLDFWRK GRFLVRTDAQ LVSYKDGATR LSKSWRTWNT PELTFVSPIA  720
VVGGRKTSLI LKGRNLTIPG TQIHCTSTGK YISKEVLCSA YPGTIYDDSG VETFDLPGEP  780
HLILGRYFIE VENRFRGNSF PVIIANSSVC QELRSLEAEL EGSQFVDGSS DDQAHDARRL  840
KPKDEVLHFL NELGWLFQKA AASTSAEKSD SSGLDLMYFS TARFRYLLLF SSERDWCSLT  900
KTLLEILAKR SLASDELSQE TLEMLSEIHL LNRAVKRKSS HMARLLVQFV VVCPDDSKLY  960
PFLPNVAGPG GLTPLHLAAS IEDAVDIVDA LTDDPQQIGL SCWHSALDDD GQSPETYAKL  1020
RNNNAYNELV AQKLVDRKNN QVTIMVGKEE IHMDQSGNVG EKNKSAIQAL QIRSCNQCAI  1080
LDAGLLRRPM HSRGLLARPY IHSMLAIAAV CVCVCVFMRA LLRFNSGRSF KWERLDFGTI  1140
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-32175260184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164182SGGGGGGGGGGNSGGGGGS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.909410.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976088410.0
Expression AtlasQ6Z8M8-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g40260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g40260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2420700.0AK242070.1 Oryza sativa Japonica Group cDNA, clone: J075133L10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649921.10.0PREDICTED: squamosa promoter-binding-like protein 15
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLA0A0E0QL600.0A0A0E0QL60_ORYRU; Uncharacterized protein
STRINGBGIOSGA028994-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g40260.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP71381115
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]