PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g39980.1
Common NameLOC4346003, Os08g0510700, OSJNBa0016N23.124-1, OSNPB_080510700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 661aa    MW: 68668.1 Da    PI: 9.3861
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g39980.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.7e-093062437
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
   Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtl 37
                      W t Ed+ll++av ++G+ +W+++a++m+  R++
  LOC_Os08g39980.1 30 WGTSEDLLLACAVSRHGTASWDAVAKEMQ-SRCP 62
                      9****************************.9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.0E-52682IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-52782IPR009057Homeodomain-like
PROSITE profilePS500906.43080IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.4E-63093IPR009057Homeodomain-like
CDDcd001671.70E-63079No hitNo description
PfamPF002499.0E-93062IPR001005SANT/Myb domain
Gene3DG3DSA:1.20.920.107.1E-14276425IPR001487Bromodomain
SMARTSM002973.6E-8291407IPR001487Bromodomain
SuperFamilySSF473702.75E-14293404IPR001487Bromodomain
PfamPF004392.4E-7310391IPR001487Bromodomain
PROSITE profilePS500149.877310388IPR001487Bromodomain
CDDcd043691.81E-10313402No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MTARSGDPGV SPESSSAAAA AAGSGGGEIW GTSEDLLLAC AVSRHGTASW DAVAKEMQSR  60
CPSAAVFTPT TCRLRFRVLH RRFSGGVTAE NEDADGGEEE EEADAAAVAG WVEELRELRV  120
AELRREVEKY DLSIGSLQSK VKRLKEEREK SISGETKPPP AAAAVKEEEE DVRKGSPEEA  180
GAVEDRVSGH ESGRSCKESN SSDLKRPEND PAVADDDDRE AEEEEEAAAA PAAGDIAVKE  240
EASGESVAGS KEADVEKESS DVQSSASPSR RRRRKGGGGG EEAEAASPSV SVPLPAAEAE  300
PLVAFLESVR TSKAGAVFER RLDSQDGERY SGTIRRHVDL ETVRSRLVGA TAAAAAAACY  360
ASASEFYRDM MLLCANALVF FPRGSPEHAA ALQLRALVSK QVSKDRQPHA GAKAPAAAAE  420
EEEKKKPAKA DADIAGPLLE KAPIIVCRKR SSIAKAAAAA AKGEKAEKAE TDKKEKDGSE  480
EKKKAAAAAT TATAAATAKD KKARGMRTNK SRGPARNQKT AKLSETGEGT KKSDKKGGGG  540
GGSSSAGAAA GGVAKKRNAV DFLNRMNQNG SPSTERVSLL ETLKLSAAAT EQQKKSSSSS  600
SGKGDGRKEA GGSGSKKGAA ASTPPGRRIG RPPKRAAAPP TPPPSKRAKD DKPTRKRGKK  660
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.540070.0callus| leaf| panicle| root| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329864630.0
Expression AtlasQ84YJ6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g39980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g39980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8588400.0HQ858840.1 Oryza sativa Japonica Group isolate UT1508 MYB-related transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650505.10.0PREDICTED: side tail fiber protein homolog from lambdoid prophage Rac isoform X1
TrEMBLA2YWX50.0A2YWX5_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0QL280.0A0A0E0QL28_ORYRU; Uncharacterized protein
TrEMBLQ84YJ60.0Q84YJ6_ORYSJ; DNA-binding protein family-like
STRINGBGIOSGA026697-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g39980.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP38051123
MonocotsOGMP31812648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44430.17e-16DNA-binding bromodomain-containing protein