PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g39890.1
Common NameB1168A08.33, Os08g0509600, OSJNBa0016N23.108, SPL14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 418aa    MW: 42378.8 Da    PI: 9.6244
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g39890.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.33.8e-42103180178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +CqvegC adls +k+y+ rhkvC +hskap v+v+gleqrfCqqCsrfh l efD++krsCrrrLa+hnerrr++q+
  LOC_Os08g39890.1 103 RCQVEGCGADLSGIKNYYCRHKVCFMHSKAPRVVVAGLEQRFCQQCSRFHLLPEFDQGKRSCRRRLAGHNERRRRPQT 180
                       6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-35100165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.47101178IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-40102181IPR004333Transcription factor, SBP-box
PfamPF031104.9E-32104177IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MEMASGGGAA AAAGGGVGGS GGGGGGGDEH RQLHGLKFGK KIYFEDAAAA AGGGGTGSGS  60
GSASAAPPSS SSKAAGGGRG GGGKNKGKGV AAAAPPPPPP PPRCQVEGCG ADLSGIKNYY  120
CRHKVCFMHS KAPRVVVAGL EQRFCQQCSR FHLLPEFDQG KRSCRRRLAG HNERRRRPQT  180
PLASRYGRLA ASVGEHRRFR SFTLDFSYPR VPSSVRNAWP AIQPGDRISG GIQWHRNVAP  240
HGHSSAVAGY GANTYSGQGS SSSGPPVFAG PNLPPGGCLA GVGAATDSSC ALSLLSTQPW  300
DTTTHSAAAS HNQAAAMSTT TSFDGNPVAP SAMAGSYMAP SPWTGSRGHE GGGRSVAHQL  360
PHEVSLDEVH PGPSHHAHFS GELELALQGN GPAPAPRIDP GSGSTFDQTS NTMDWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-291041771184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17682GGRGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.66360.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329924000.0
Expression AtlasQ7EXZ2-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g39890.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g39890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071910.0AK107191.1 Oryza sativa Japonica Group cDNA clone:002-125-A04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650813.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ7EXZ20.0SPL14_ORYSJ; Squamosa promoter-binding-like protein 14
TrEMBLD8WJ580.0D8WJ58_ORYSA; IPA1
STRINGLOC_Os08g39890.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.16e-42squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]