PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g39830.2
Common NameB1168A08.22, LOC4345992, Os08g0508700, OSJNBb0064I19.34, OSNPB_080508700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family EIL
Protein Properties Length: 620aa    MW: 69161.5 Da    PI: 6.9074
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g39830.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3421.31e-128384221354
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       eel +rmwkd+++lkr+ker+++l + ++aa++++k++k++eqa rkk++r QDgiL+YMlk mevcna+GfvYgiip+kgkpv+gasd++ra
  LOC_Os08g39830.2  38 EELARRMWKDKIKLKRIKERQQKL-ALQQAALEESKTKKMSEQALRKKTARVQDGILRYMLKLMEVCNARGFVYGIIPHKGKPVSGASDNIRA 129
                       8********************986.577778************************************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWkekv+fd ngp+ai+ky+ kn +l +++++   +  ++hsl++lqD+tlgSLLs+lmqhc+p+qr++pl+kgv+pPWWP+G+e+ww +lgl
  LOC_Os08g39830.2 130 WWKEKVRFDVNGPVAIAKYEVKNSMLVDAKRR---GVLNQHSLMDLQDATLGSLLSSLMQHCSPQQRKYPLDKGVPPPWWPSGNEDWWISLGL 219
                       ***************************99999...88******************************************************** PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX.XX....XXXXXXXXX CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah.ss....slrkqspkv 274
                       +   + ppy+kphdlkk+wkv+vLt vikhm+p++++ir+++r+sk+lqdkm+akes ++l vl++ee  +++     s+    s+r+++ + 
  LOC_Os08g39830.2 220 PMGIS-PPYRKPHDLKKVWKVGVLTGVIKHMAPNFDKIRNCVRKSKCLQDKMTAKESLIWLGVLRREEIYFRSSDNVgSQithrSSREGKSDD 311
                       **999.9*************************************************************98876554453355669999***** PP

                       XXXXXXXXXXXXXXXXX.XXXXXXXXXX.................................XXXXXXXXXXXXXXXXXXXXX......XXXXX CS
              EIN3 275 tlsceqkedvegkkeskikhvqavktta.................................gfpvvrkrkkkpsesakvsskevsrtcqssqf 334
                       ++s+++++dv+  +e+  +++++++  +                                 g++  rkrk+++++  +++s+  +++ + +q+
  LOC_Os08g39830.2 312 IYSSSDEYDVDHLEEPPRSSSSKDNVGRrqptaqireehtssrhnrgrhdqqpnqvlpsneGTNESRKRKRPSGHLLTAESEVEVTQKDDNQL 404
                       ***********7777776777777766678888999999999*******************99*******99999999999866667777777 PP

                       XX.XXXXXXXXXXXXXXXXX CS
              EIN3 335 rgsetelifadknsisqney 354
                           +++ ++++++i+q+e+
  LOC_Os08g39830.2 405 A--IVSNALPNMSRINQTEM 422
                       6..9************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.0E-12538286No hitNo description
Gene3DG3DSA:1.10.3180.102.7E-67162290IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.76E-62166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MGNPSILTED LGDTSDFEVD GVENLTENDV SDEEIDAEEL ARRMWKDKIK LKRIKERQQK  60
LALQQAALEE SKTKKMSEQA LRKKTARVQD GILRYMLKLM EVCNARGFVY GIIPHKGKPV  120
SGASDNIRAW WKEKVRFDVN GPVAIAKYEV KNSMLVDAKR RGVLNQHSLM DLQDATLGSL  180
LSSLMQHCSP QQRKYPLDKG VPPPWWPSGN EDWWISLGLP MGISPPYRKP HDLKKVWKVG  240
VLTGVIKHMA PNFDKIRNCV RKSKCLQDKM TAKESLIWLG VLRREEIYFR SSDNVGSQIT  300
HRSSREGKSD DIYSSSDEYD VDHLEEPPRS SSSKDNVGRR QPTAQIREEH TSSRHNRGRH  360
DQQPNQVLPS NEGTNESRKR KRPSGHLLTA ESEVEVTQKD DNQLAIVSNA LPNMSRINQT  420
EMMGMANQMT SLSHVNTTET LQHQYVQGNF VSSPAAVVNN YNSNQITNVN PSRIYMGYQP  480
LACQNNGHTN PWSEDTFQVD VGPPPIGFTT NSSSGGNHSF PMKQSLPKSI DDHVPITETG  540
VLADSSSYGY HITATGSRNS TSVAGHGNQL MGDPFDSGTA DKFNGNSFDG LPFDFIGSSP  600
IPDIGVLLDD DDIMPYLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-611662929135ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.534030.0callus| flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329824850.0
Expression AtlasQ6YVT1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g39830.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g39830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0058160.0AP005816.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:B1168A08.
GenBankAP0052540.0AP005254.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBb0064I19.
GenBankAK0724620.0AK072462.1 Oryza sativa Japonica Group cDNA clone:J023115E06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648717.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-137EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLQ6YVT10.0Q6YVT1_ORYSJ; Os08g0508700 protein
STRINGLOC_Os08g39830.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-126ETHYLENE-INSENSITIVE3-like 3