PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g38990.3
Common NameLOC4345940, OJ1118_A06.2, Os08g0499300, OSNPB_080499300, WRKY30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 675aa    MW: 73261.3 Da    PI: 7.7603
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g38990.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.93.2e-31277332259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+vk+se+prsYY+Ct+++C vkk vers+ d++++ei+Y+g+Hnh+
  LOC_Os08g38990.3 277 EDGYNWRKYGQKQVKNSEHPRSYYKCTFTNCAVKK-VERSQ-DGQITEIVYKGSHNHP 332
                       8*******************************998.****9.***************7 PP

2WRKY105.52.9e-33487545159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+vers++d k v++tYeg+Hnhe
  LOC_Os08g38990.3 487 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCSVRKHVERSSHDLKSVITTYEGKHNHE 545
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-27272334IPR003657WRKY domain
SuperFamilySSF1182904.71E-24274334IPR003657WRKY domain
SMARTSM007745.3E-35276333IPR003657WRKY domain
PfamPF031062.4E-23277332IPR003657WRKY domain
PROSITE profilePS5081120.53277334IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-37472547IPR003657WRKY domain
SuperFamilySSF1182904.45E-29479547IPR003657WRKY domain
PROSITE profilePS5081137.597482547IPR003657WRKY domain
SMARTSM007741.7E-38487546IPR003657WRKY domain
PfamPF031062.7E-25488545IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MDGTNNHGAL MDDWMLPSPS PRTLMSSFLN EEFSSGPFSD IFCDNGSNKH QDGLGKSKAF  60
IDSSREETAQ LAKKFESNLF GANQKSSSNG CLSERMAART GFGVLKIDTS RVGYSTPIRS  120
PVTIPPGVSP RELLESPVFL PNAIAQPSPT TGKLPFLMHS NVKPSIPKKT EDETRHDRVF  180
FFQPILGSKP PTCPVAEKGF SVNHQNQPSV TDNHQELSLQ SSSTAAKDFT SATIVKPKTS  240
DSMLDNDDHP SPANDQEENA TNKNEEYSSD LIITPAEDGY NWRKYGQKQV KNSEHPRSYY  300
KCTFTNCAVK KVERSQDGQI TEIVYKGSHN HPLPPSNRRP NVPFSHFNDL RDDHSEKFGS  360
KSGQATATSW ENAANGHLQD VGSEVLTKLS ASLTTTEHAE KSVMDKQEAV DISSTLSNEE  420
DDRVTHRAPL SLGFDANDDY VEHKRRKMDV YAATSTSTNA IDIGAVASRA IREPRVVVQT  480
TSEVDILDDG YRWRKYGQKV VKGNPNPRSY YKCTHPGCSV RKHVERSSHD LKSVITTYEG  540
KHNHEVPAAR NSGHPSSGSA AAPQATNGLL HRRPEPAQGG GGGSLAQFGY GSAGHRPAEQ  600
FGAAAAGFSF GMLPRSIATP APSPAIAVPA MQGYPGLVLP RGEMKVNLLP QSGNAGAAAS  660
QQLMGRLPKQ HPQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36277548878Probable WRKY transcription factor 4
2lex_A1e-36277548878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.273210.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6ZKN0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g38990.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g38990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2981800.0DQ298180.1 Oryza sativa (japonica cultivar-group) WRKY transcription factor 30 mRNA, complete cds.
GenBankCT8288690.0CT828869.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI216M15, full insert sequence.
GenBankCT8288680.0CT828868.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI209L14, full insert sequence.
GenBankAY8706100.0AY870610.1 Oryza sativa (japonica cultivar-group) WRKY30 mRNA, complete cds.
GenBankAK0655180.0AK065518.1 Oryza sativa Japonica Group cDNA clone:J013025I24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650158.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015650159.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015650160.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015650162.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015650163.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015650164.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015650165.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLB8BC430.0B8BC43_ORYSI; Putative uncharacterized protein
TrEMBLQ6ZKN00.0Q6ZKN0_ORYSJ; Os08g0499300 protein
STRINGBGIOSGA026734-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g38990.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-116WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Ryu HS, et al.
    A comprehensive expression analysis of the WRKY gene superfamily in rice plants during defense response.
    Plant Cell Rep., 2006. 25(8): p. 836-47
    [PMID:16528562]