PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g38590.1
Common NameB1142B04.1, Os08g0494100, OSNPB_080494100, P0686H11.33
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 338aa    MW: 36193.5 Da    PI: 4.436
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g38590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.43.9e-28958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien++nrqvtfskRrng++KKA+ELSvLCd++va+++fs++g+l  +s
  LOC_Os08g38590.1  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDIDVALLMFSPSGRLSHFS 58
                      79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.422161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-30288IPR002100Transcription factor, MADS-box
CDDcd002655.99E-38275No hitNo description
PRINTSPR004042.5E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRVKLPIKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD IDVALLMFSP SGRLSHFSGR  60
RGVEDVILRY MNLSEHDRGE AIQNREEIQQ EIYSSQQQLQ ITEDRLRMFE PDPAAFGTSS  120
EVDGCEKYLM ELLTRVVERK NNLLSSHMAP FDATTAAMQG ADGTQMYVSQ ADGLATFGGD  180
AAMWGPDGGA DPGHPMFSAS DPLIYLRDHD VYDANSQVAG LHGGDPCAAG GAAAAAAAVG  240
CVDDDVAGGH AAAADAWRQA YTCTELLSTL IPTTPFPLMP HCLGPEDQYL SMEHGMVAAA  300
QEPVEASTAS CSYVPSDENS GTPVMAYDSN PPPANIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-17175174Myocyte-specific enhancer factor 2B
1tqe_Q1e-17175174Myocyte-specific enhancer factor 2B
1tqe_R1e-17175174Myocyte-specific enhancer factor 2B
1tqe_S1e-17175174Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6Z5F8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g38590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g38590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565040.0FM956504.1 Oryza sativa Japonica Group mRNA for MADS62 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649547.10.0PREDICTED: agamous-like MADS-box protein AGL66
TrEMBLA2YWK70.0A2YWK7_ORYSI; Putative uncharacterized protein
TrEMBLQ6Z5F80.0Q6Z5F8_ORYSJ; Os08g0494100 protein
STRINGBGIOSGA026745-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g38590.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.19e-49AGAMOUS-like 104