PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g38020.1
Common NameLOC4345889, Os08g0487100, OSNPB_080487100, P0028A08.8, P0481F05.29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 231aa    MW: 24837.7 Da    PI: 7.7072
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g38020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.32.8e-12120180363
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       e +r rr+ +NRe+ArrsR RK+ ++ eL   v+ L + N++L +el++    +a ++ e+
  LOC_Os08g38020.1 120 EERRRRRMVSNRESARRSRMRKQRQLSELWAQVEHLRGANRRLLDELNRALRGCADVRREN 180
                       67899*******************************************9888887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-12118182IPR004827Basic-leucine zipper domain
PfamPF001701.6E-9119178IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.772120183IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-10122170No hitNo description
Gene3DG3DSA:1.20.5.1702.1E-9122194No hitNo description
PROSITE patternPS000360125140IPR004827Basic-leucine zipper domain
CDDcd147021.47E-14127171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MYHHHHGGHG EVASLHLLSP PNPPFFGAAA HHHHHHHGLI NMALPPQAYF VPAAPPPPFQ  60
EATAALAAGD DATAALAVFE LERILEEAAA AGGGGGNGSP SSGSDGCCYG LQGVAPAAEE  120
ERRRRRMVSN RESARRSRMR KQRQLSELWA QVEHLRGANR RLLDELNRAL RGCADVRREN  180
SRLRDEKAEL AGKLQLLLPR QPAPEKNAAD DQSSCSSEPC KNSTTTTAAE *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134141RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.315480.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329923590.0
Expression AtlasQ6ZCW4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g38020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g38020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0045570.0AP004557.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0028A08.
GenBankAP0043760.0AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649077.11e-167PREDICTED: transcription factor Maf
TrEMBLA0A0E0IDL31e-167A0A0E0IDL3_ORYNI; Uncharacterized protein
TrEMBLB8BC451e-167B8BC45_ORYSI; Putative uncharacterized protein
TrEMBLQ6ZCW41e-167Q6ZCW4_ORYSJ; Os08g0487100 protein
STRINGBGIOSGA026766-PA1e-167(Oryza sativa Indica Group)
STRINGLOC_Os08g38020.11e-167(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1302545
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38800.13e-10basic leucine-zipper 43