PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g37970.1
Common NameOs08g0486300, P0481F05.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 358aa    MW: 36754.2 Da    PI: 6.5683
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g37970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEde+l++++++ G g+W+t +r  g++R++k+c++rw +yl
  LOC_Os08g37970.1 14 KGPWTPEEDEKLLHYIQKNGHGSWRTLPRLAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding55.11.8e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
  LOC_Os08g37970.1  67 RGKFSQEEEQTILHLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.45961IPR017930Myb domain
SuperFamilySSF466891.28E-3111108IPR009057Homeodomain-like
SMARTSM007178.7E-151363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001671.29E-111661No hitNo description
PROSITE profilePS5129426.79662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2765117IPR009057Homeodomain-like
SMARTSM007179.2E-1766114IPR001005SANT/Myb domain
PfamPF002492.5E-1667112IPR001005SANT/Myb domain
CDDcd001671.51E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000032anatomytetrad of microspores
PO:0001029developmental stageE tetrad stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDEKLLHYIQ KNGHGSWRTL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILH LHSILGNKWS AIATHLPGRT DNEIKNFWNT HLKKRLIQMG  120
FDPMTHRPRT DFFAALPQLI ALATLRDQLA ATACGGGGGG DTAAAAAAQI MQGAGGGGGA  180
DVAIQAAKMQ YLQCLLQSAA STIASAGSGG GGGGAMSAHD ADAALAAAAA AAATCSSSPA  240
GSSVPITPTA VGHSGGGQTQ TTPCAFSEAP VITSDDVEAN LRLLGCGAGG ADAFTCHGGS  300
LPPLADLSDV TTTTMTNPLD WCSATASASS CGGGGGASSP FPWPEFFHDD PFITDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154769970.0
Expression AtlasQ6ZDR4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g37970.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g37970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0043760.0AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973754.11e-136PREDICTED: myb-related protein Hv33-like
SwissprotQ8GWP02e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLQ6ZDR40.0Q6ZDR4_ORYSJ; Os08g0486300 protein
STRINGLOC_Os08g37970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.15e-94myb domain protein 93