PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g37580.1
Common NameHOX20, LOC4345854, Os08g0481400, OSJNBb0092C08.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 270aa    MW: 28928.9 Da    PI: 4.3781
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g37580.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-194396356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      k+++++ eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  LOC_Os08g37580.1 43 KKRRLSVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 96
                      456899***********************************************9 PP

2HD-ZIP_I/II134.44e-4342134193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls eqv++LE+sFe+e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal++++++L++++++L +e+ke
  LOC_Os08g37580.1  42 EKKRRLSVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRQSYDALRADHDALRRDKDALLAEIKE 134
                       69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.38E-1930100IPR009057Homeodomain-like
PROSITE profilePS5007117.3943898IPR001356Homeobox domain
SMARTSM003891.6E-1841102IPR001356Homeobox domain
PfamPF000462.3E-164396IPR001356Homeobox domain
CDDcd000864.44E-184399No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1945105IPR009057Homeodomain-like
PRINTSPR000319.1E-66978IPR000047Helix-turn-helix motif
PROSITE patternPS0002707396IPR017970Homeobox, conserved site
PRINTSPR000319.1E-67894IPR000047Helix-turn-helix motif
PfamPF021837.4E-1898139IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MRSPAALLPV VADGGGGVGV EEEMDVDEDM AMCGGRGGGG GEKKRRLSVE QVRALERSFE  60
TENKLEPERK ARLARDLGLQ PRQVAVWFQN RRARWKTKQL ERDYAALRQS YDALRADHDA  120
LRRDKDALLA EIKELKGKLG DEDAAASFSS VKEEEDPAAS DADPPATGAP QGSSESDSSA  180
VLNDAEILPH KPAPAAAADA AASEETEAVV TGAALLHHAE VFFHGQLLKV DDDEAAFLGD  240
DGAACGGFFA DEHLPSLPWW AEPTEQWTT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13340GGRGGGGG
26773ERKARLA
39098RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.280340.0leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329920270.0
Expression AtlasQ6Z248-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g37580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g37580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8294460.0CT829446.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA031N19, full insert sequence.
GenBankAK1068180.0AK106818.1 Oryza sativa Japonica Group cDNA clone:002-116-D05, full insert sequence.
GenBankAK0682440.0AK068244.1 Oryza sativa Japonica Group cDNA clone:J013140I04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650851.10.0PREDICTED: homeobox-leucine zipper protein HOX20
SwissprotA2YWC00.0HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
SwissprotQ6Z2480.0HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
TrEMBLA0A0E0IDG50.0A0A0E0IDG5_ORYNI; Uncharacterized protein
STRINGBGIOSGA026788-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g37580.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-46homeobox protein 5
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]