PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g37400.1
Common NameLOC4345845, OJ1113_A10.19, Os08g0479400, OsJ_27685, ZHD2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 291aa    MW: 29759.2 Da    PI: 7.0575
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g37400.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.31.6e-3261115459
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       +rY+eClkNhA+ +GghavDGCgEfm+s geeg+++al+CaACgCHRnFHR+e+e+
  LOC_Os08g37400.1  61 ARYRECLKNHAVGIGGHAVDGCGEFMAS-GEEGSIDALRCAACGCHRNFHRKESES 115
                       79*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.1E-2961113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-3062112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2562115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.03363112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.2E-20216287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-32218288IPR009057Homeodomain-like
TIGRFAMsTIGR015657.0E-26226282IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MDFDDHDEGD GDEEMPPMPL SSGYDAPMQP GLGGGGGGVP KPGGGVGGGG GGGGGGGGGG  60
ARYRECLKNH AVGIGGHAVD GCGEFMASGE EGSIDALRCA ACGCHRNFHR KESESPTGVG  120
PAEPSAVSPA AISAYGASPH HQFSPYYRTP AGYLHHQQHQ MAAAAAAAAA AAAGGYPQRP  180
LALPSTSHSG RDEGDDMSGM VGPMVIGPMV GMSLGSAGPS GSGSGKKRFR TKFTQEQKDK  240
MLAFAERLGW RIQKHDEAAV QQFCEEVCVK RHVLKVWMHN NKHTLGKKAP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-292272841875ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.180460.0callus| flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329947370.0
Expression AtlasQ6ZB90-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g37400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g37400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0046430.0AP004643.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1113_A10.
GenBankAK1095280.0AK109528.1 Oryza sativa Japonica Group cDNA clone:002-116-C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649557.10.0PREDICTED: zinc-finger homeodomain protein 2
SwissprotA2YWA60.0ZHD2_ORYSI; Zinc-finger homeodomain protein 2
SwissprotQ6ZB900.0ZHD2_ORYSJ; Zinc-finger homeodomain protein 2
TrEMBLA0A0E0AWN60.0A0A0E0AWN6_9ORYZ; Uncharacterized protein
TrEMBLI1QJI00.0I1QJI0_ORYGL; Uncharacterized protein
STRINGBGIOSGA026798-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g37400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-60homeobox protein 22
Publications ? help Back to Top
  1. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]