PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g36790.1
Common NameABA1, Os08g0472000, P0013B04.7, TRAB1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 330aa    MW: 34770.3 Da    PI: 9.0023
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g36790.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.87.5e-16243294556
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ ee+ ++ 
  LOC_Os08g36790.1 243 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNMELQKKQEEIMEMQ 294
                       79********************************************999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-14239303IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.208241292IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-12243293No hitNo description
PfamPF001703.3E-14243295IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-15243292No hitNo description
CDDcd147077.61E-25243295No hitNo description
PROSITE patternPS000360246261IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGGGLGKDFG SMNMDELLRS IWTAEESQAM ASASAAAAAA EGGLQRQGSL TLPRTLSVKT  60
VDEVWRDLER EASPGAAAAD GGGGGGEQQQ PRRQPTLGEM TLEEFLVRAG VVRENTAAAA  120
AMVAAAAAPP VAPRSIPAVN NSSIFFGNYG GVNDAAAAAA GAMGFSPVGI GDPTMGNRLM  180
SGVAGIGGGA ITVAPVDTSV GQMDSAGKGD GDLSSPMAPV PYPFEGVIRG RRSGGNVEKV  240
VERRQRRMIK NRESAARSRA RKQAYTMELE AEVQKLKEQN MELQKKQEEI MEMQKNFFPE  300
MQKNQVLEAV NNPYGQKKRC LRRTLTGPW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.43790.0panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO330870680.0
Expression AtlasQ6ZDF3-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves and embryos. {ECO:0000269|PubMed:10611387}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g36790.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q6ZDF3
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g36790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3234820.0AY323482.1 Oryza sativa (japonica cultivar-group) bZIP transcription factor (aba1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650926.10.0PREDICTED: bZIP transcription factor TRAB1
SwissprotQ6ZDF30.0TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A0P0XGN70.0A0A0P0XGN7_ORYSJ; Os08g0471950 protein (Fragment)
STRINGLOC_Os08g36790.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5401580
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.33e-40ABRE binding factor 4
Publications ? help Back to Top
  1. Hobo T,Kowyama Y,Hattori T
    A bZIP factor, TRAB1, interacts with VP1 and mediates abscisic acid-induced transcription.
    Proc. Natl. Acad. Sci. U.S.A., 1999. 96(26): p. 15348-53
    [PMID:10611387]
  2. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]