PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g36220.1
Common NameHOX27, LOC9271357, Os08g0465000, OSJNOa174H12.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 355aa    MW: 36889.3 Da    PI: 7.472
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g36220.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.7e-18173227256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  LOC_Os08g36220.1 173 RKKLRLSKEQSAFLEESFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 227
                       788899***********************************************98 PP

2HD-ZIP_I/II128.43.1e-41173263192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlskeq+++LEesF+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  LOC_Os08g36220.1 173 RKKLRLSKEQSAFLEESFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELR-ALK 263
                       69*************************************************************************************9.665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-18157227IPR009057Homeodomain-like
SuperFamilySSF466891.84E-18159230IPR009057Homeodomain-like
PROSITE profilePS5007117.167169229IPR001356Homeobox domain
SMARTSM003896.3E-16171233IPR001356Homeobox domain
CDDcd000861.98E-17173230No hitNo description
PfamPF000461.8E-15173227IPR001356Homeobox domain
PROSITE patternPS000270204227IPR017970Homeobox, conserved site
SMARTSM003403.5E-25229272IPR003106Leucine zipper, homeobox-associated
PfamPF021831.0E-10229263IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MELGLSLGDA VTVADGGRLE LVLGLGVGVG AGVRRGEEEE RGRREDVVGA GRWAAMAAAS  60
PEPSVRLSLV SSLGLHWPSE TGRSEAAARG FDVNRAPSVA AGAPGMEDDE EGPGAAPALS  120
SSPNDSGGSF PLDLSGQGLR GHAEAAAQGG GGGGGGERSS SRASDDDEGA SARKKLRLSK  180
EQSAFLEESF KEHSTLNPKQ KVALAKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR  240
CCETLTEENR RLHKELAELR ALKTARPFYM HLPATTLSMC PSCERVASNP ATASTSAPAA  300
ATSPAAAPTA AARTAVASPE PHRPSSFAAL FAAPLGFPLT AAQPRPPPPA SNCL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221229RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.805230.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977264980.0
Expression AtlasQ6YPD0-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g36220.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g36220
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411960.0AK241196.1 Oryza sativa Japonica Group cDNA, clone: J065121H01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648883.10.0PREDICTED: homeobox-leucine zipper protein HOX27 isoform X2
SwissprotQ6YPD00.0HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLB9G1B30.0B9G1B3_ORYSJ; Uncharacterized protein
STRINGLOC_Os08g36220.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-69homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]