PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g33940.1
Common NameLOC9272734, Os08g0437200, OSJNBa0016C11.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 311aa    MW: 32785.8 Da    PI: 7.9836
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g33940.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.3e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  LOC_Os08g33940.1 14 KGPWTPEEDLMLVAYVQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding51.42.6e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  LOC_Os08g33940.1  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.434965IPR017930Myb domain
SuperFamilySSF466892.24E-3012108IPR009057Homeodomain-like
SMARTSM007174.5E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001672.92E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129420.42766116IPR017930Myb domain
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002495.1E-1567112IPR001005SANT/Myb domain
CDDcd001675.76E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGRPPCCVKA EVKKGPWTPE EDLMLVAYVQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMS  120
ATGGGGDDGE GGGAGEVKTR AAAPKGQWER RLQTDIHTAR QALRDALSLD PSPPAKPLDS  180
SSGATAPPSS QAATSYASSA ENIARLLEGW MRPGGGGGKT TTTPSSGSRS SAASVLSGEA  240
SHSGGATAPT PDGSTVTSKT KDEETAGAPP PPPPPAFSML ESWLLDDGMG HGEVGLMDVV  300
VPLGDPSEFF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-27111161105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-261111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.594960.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166314220.0
Expression AtlasQ6Z535-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00235DAPTransfer from AT1G74650Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g33940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g33940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377780.0CT837778.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA023K22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648957.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-102MYB06_ANTMA; Myb-related protein 306
TrEMBLQ6Z5350.0Q6Z535_ORYSJ; Os08g0437200 protein
STRINGLOC_Os08g33940.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.22e-91myb domain protein 96