PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g33910.1
Common NameLOC4345668, Os08g0436700, OsJ_27451, OSJNBa0016C11.11, OSNPB_080436700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 386aa    MW: 43336.7 Da    PI: 8.2696
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g33910.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-52161431128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       l pGfrFhPtdeelv++yLk+k+++k++++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++
  LOC_Os08g33910.1  16 LLPGFRFHPTDEELVSFYLKRKIQQKPISI-ELIRQLDIYKFDPWDLPKLASTGEKEWYFYCPRDRKYRNSVRPNRVTTAGFWKATGTDRPIY 107
                       579***************************.89***************9888999************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+ +++ +glkk+Lvfykgra +g ktdW+mhe+rl
  LOC_Os08g33910.1 108 STeGTKCIGLKKSLVFYKGRAARGIKTDWMMHEFRL 143
                       *956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5715174IPR003441NAC domain
PROSITE profilePS5100556.8316174IPR003441NAC domain
PfamPF023659.7E-2618143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MEERNDVNMD KSDEILLPGF RFHPTDEELV SFYLKRKIQQ KPISIELIRQ LDIYKFDPWD  60
LPKLASTGEK EWYFYCPRDR KYRNSVRPNR VTTAGFWKAT GTDRPIYSTE GTKCIGLKKS  120
LVFYKGRAAR GIKTDWMMHE FRLPTLTDPS LPKKPIDKNI PLNDSWTICR IFKKTSSMAQ  180
RALCQTWGAQ LPGTIDPDIF STLQSVQASQ FALESSSCSL QAAATAAHQI TSKYALQGNN  240
NNQQQQQQHK PSNPLDGSSC KVINFNCSQS AEVQNSQIIL PFEAHTSQKT ATPLLFDTQF  300
GQPDQISRFV VDSSVNANGG GISNKSQDPS ARKPGSGFSM NSDWDGVARI NFPFDLGADS  360
SEDWRSSIPW ESFLSPTTVH AEMPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531617717168NO APICAL MERISTEM PROTEIN
1ut4_B2e-531617717168NO APICAL MERISTEM PROTEIN
1ut7_A2e-531617717168NO APICAL MERISTEM PROTEIN
1ut7_B2e-531617717168NO APICAL MERISTEM PROTEIN
4dul_A2e-531617717168NAC domain-containing protein 19
4dul_B2e-531617717168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.535060.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329830360.0
Expression AtlasQ6Z538-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g33910.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g33910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0730130.0AK073013.1 Oryza sativa Japonica Group cDNA clone:J033000B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649454.10.0PREDICTED: protein FEZ
SwissprotQ9ZVH02e-98FEZ_ARATH; Protein FEZ
TrEMBLQ6Z5380.0Q6Z538_ORYSJ; Os08g0436700 protein
STRINGLOC_Os08g33910.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-99NAC family protein