PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g33750.2
Common NameOs08g0434700, OSNPB_080434700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 261aa    MW: 28220.6 Da    PI: 5.795
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g33750.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like46.58e-159382655
           G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                       AtPk++l++m v+gLtl+h+kSHLQkYR 
  LOC_Os08g33750.2  9 GATPKSVLRAMAVPGLTLYHLKSHLQKYRQ 38
                      59***************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-5840IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-14942IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-9938IPR006447Myb domain, plants
PfamPF143792.9E-14102142IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MSSQQQHAGA TPKSVLRAMA VPGLTLYHLK SHLQKYRQAV SRGGNGGGGG SGSLNDRSSS  60
SERQPADHDG DSAADEPRTI AYDGDSDGDA KEGLRDSSRS MVQMQREVQR KLQEQIEVKR  120
HLQLRMEAQG RYLQSVLRRA QQVLADHSLA SSPEAATAEL SELASAVDIE CMSSSSPPRH  180
HRQSAATDSC VTTTSSSEAE SKAAGSKRLH TSDCTVEQPV QGKRAFNFLQ RHNQADQEEE  240
QEEEYAGAED GSSSEIDLNR *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.491230.0callus| flower| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329803620.0
Expression AtlasQ0J5H1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g33750.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g33750
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0703380.0AK070338.1 Oryza sativa Japonica Group cDNA clone:J023049D17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650853.10.0PREDICTED: myb family transcription factor APL
TrEMBLQ0J5H10.0Q0J5H1_ORYSJ; Os08g0434700 protein (Fragment)
TrEMBLQ6YWK60.0Q6YWK6_ORYSJ; Putative transfactor
STRINGLOC_Os08g33750.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-29G2-like family protein