PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g33488.1
Common NameMADS23, OJ1111_B08.22, Os08g0431900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 160aa    MW: 18361.9 Da    PI: 9.7976
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g33488.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.92e-26959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      kri+n + rqvtfskRr g++KKA ELS+LCdaev +++fsst +ly+++s
  LOC_Os08g33488.1  9 KRIDNATSRQVTFSKRRSGLFKKARELSILCDAEVGLLVFSSTSRLYDFAS 59
                      79***********************************************86 PP

2K-box769.8e-2681156984
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                       +++++a+ +qqe+a L+++++nLq+ +R+llG++L+ L++++Lq+Le++Le slk+iR +K++++++qi+el +k 
  LOC_Os08g33488.1  81 NASSEAKLWQQEAASLRQQLHNLQEYHRQLLGQQLSGLDVEDLQNLESKLEMSLKNIRLRKDNVMMDQIQELSRKV 156
                       6788999*****************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.113161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-32290IPR002100Transcription factor, MADS-box
CDDcd002659.35E-44275No hitNo description
PRINTSPR004041.4E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-283859IPR002100Transcription factor, MADS-box
PfamPF014865.2E-2382155IPR002487Transcription factor, K-box
PROSITE profilePS5129713.32586159IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001059developmental stageJ bicellular pollen stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MGRGKIEIKR IDNATSRQVT FSKRRSGLFK KARELSILCD AEVGLLVFSS TSRLYDFASS  60
SMKSIIERYN ETKEDPHQTM NASSEAKLWQ QEAASLRQQL HNLQEYHRQL LGQQLSGLDV  120
EDLQNLESKL EMSLKNIRLR KDNVMMDQIQ ELSRKVVTT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-23179178Myocyte-specific enhancer factor 2B
1tqe_R7e-23179178Myocyte-specific enhancer factor 2B
1tqe_Q7e-23179178Myocyte-specific enhancer factor 2B
1tqe_P7e-23179178Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO336211140.0
Expression AtlasQ6VAM4-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedling roots and developing seeds. {ECO:0000269|PubMed:14701936}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g33488.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g33488
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3452200.0AY345220.1 Oryza sativa (japonica cultivar-group) transcription factor MADS23 mRNA, complete cds; alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650845.11e-110PREDICTED: MADS-box transcription factor 23 isoform X2
RefseqXP_015650846.11e-110PREDICTED: MADS-box transcription factor 23 isoform X2
RefseqXP_015650847.11e-110PREDICTED: MADS-box transcription factor 23 isoform X3
SwissprotQ6VAM41e-116MAD23_ORYSJ; MADS-box transcription factor 23
TrEMBLI1QIW91e-113I1QIW9_ORYGL; Uncharacterized protein
STRINGLOC_Os08g33488.11e-113(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.15e-73AGAMOUS-like 21
Publications ? help Back to Top
  1. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]