PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g33150.1
Common NameLOC4345623, OJ1663_D06.19, Os08g0428200, OSJNBb0032E15.126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 310aa    MW: 34283 Da    PI: 5.4021
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g33150.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.9e-151461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+      G  +W+++++  g+ R++k+c++rw +yl
  LOC_Os08g33150.1 14 KGPWTAEEDQKLITFLLTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding543.9e-1771111547
                       -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +  E+++ vd+++qlG++ W++Ia++++ gRt++++k++w+++
  LOC_Os08g33150.1  71 SDAEEKIVVDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                       778***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-19562IPR009057Homeodomain-like
PROSITE profilePS5129413.843961IPR017930Myb domain
SuperFamilySSF466895.62E-2611108IPR009057Homeodomain-like
SMARTSM007173.1E-121363IPR001005SANT/Myb domain
PfamPF002498.2E-141461IPR001005SANT/Myb domain
CDDcd001673.57E-81661No hitNo description
PROSITE profilePS5129426.56762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2463117IPR009057Homeodomain-like
SMARTSM007174.8E-1566114IPR001005SANT/Myb domain
PfamPF002492.3E-1471111IPR001005SANT/Myb domain
CDDcd001678.76E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLITFLL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDAEEKIVVD LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPLTHRPLQ PPPSPSPEKK HAERKNTAAA AAVAEQHQHD ELWEEESPGF CTDEVPMIHP  180
DEIMVPLRDH PPPVCTAAGA STPTTSSSSS SSSVASSTTS CDEVDAAALL PVLEWPDDAM  240
CLMELDELIA AAAPPSLLWD DDYRLPLPPP PLSPPAMYEE LDAFQCYDQQ RSAFEQEAAA  300
SAWNKLELF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1012770.0flower| leaf| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ84NI9
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g33150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g33150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3110510.0AJ311051.1 Oryza sativa mRNA for Myb51 protein (myb51 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648743.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX65e-85ODO1_PETHY; Protein ODORANT1
TrEMBLQ84NI90.0Q84NI9_ORYSJ; Myb51 protein
TrEMBLQ8H0P20.0Q8H0P2_ORYSA; Myb51 protein
STRINGLOC_Os08g33150.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.16e-90myb domain protein 43