PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g33050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 465aa    MW: 46882.8 Da    PI: 7.5431
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g33050.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.2e-32265318255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  LOC_Os08g33050.1 265 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 318
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15262319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28263319IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23265318IPR006447Myb domain, plants
PfamPF002497.0E-7266317IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MASATSTTPD LSLHISLPSG GAAVGTTAPP GLGNGGAVGG AGGGKAAGGG DPWRRLDGST  60
ASTELSLSTP QQQQEGSTSA ADVLPWRLRQ PTAAAASVPV TLPTIPMDGS AAAARAPIRG  120
VPVYSGGGGG GHPFLGGGGG DHRHNRLYNP YHSTAWPSSS LCSTSPAPAP PPPPAALDPT  180
TSSLLSPSAY HRMLSSTGRL HGVLADTLRG YAGAAAVAGS IGYGSAAAAA AAMGGYGGAG  240
AGGGFASSRF MPRLLPASRR SMRAPRMRWT SSLHARFVHA VELLGGHERA TPKSVLELMD  300
VKDLTLAHVK SHLQMYRTVK STDKPAAASG PMDGSGSGSG SGDDELLAGD GRQATSSGAD  360
ADRRMSFTEH RSSSEGAASH AGGGGDGDCS SSAVNSDTIR ARSNSPRDLW LSSSVCNMDP  420
QHLVTVEDME PCRSSSLQVS SHELSSPSLE FTLGRPSWHS IDHD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14249GGKAAGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.55973e-69callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154790063e-69
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g33050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g33050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877880.0AK287788.1 Oryza sativa Japonica Group cDNA, clone: J065172N06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648273.10.0PREDICTED: probable transcription factor RL9
SwissprotQ0J2351e-102ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0E0IC280.0A0A0E0IC28_ORYNI; Uncharacterized protein
STRINGLOC_Os08g33050.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.15e-30G2-like family protein