PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g32080.1
Common NameHOX5, LOC4345576, Os08g0416000, OsJ_026223, P0433E10.14-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 350aa    MW: 37386.7 Da    PI: 4.3324
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g32080.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.5e-2086139356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  LOC_Os08g32080.1  86 KKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 139
                       56789************************************************9 PP

2HD-ZIP_I/II132.91.2e-4285176192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekkrrl++eqv++LE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+d+++Lk+aydal++++++L +++++Lr+++ 
  LOC_Os08g32080.1  85 EKKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEHDFDRLKAAYDALAADHHALLSDNDRLRAQVI 176
                       69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.23681141IPR001356Homeobox domain
SMARTSM003891.9E-1984145IPR001356Homeobox domain
SuperFamilySSF466897.1E-1985149IPR009057Homeodomain-like
PfamPF000463.0E-1786139IPR001356Homeobox domain
CDDcd000862.02E-1886142No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2187148IPR009057Homeodomain-like
PRINTSPR000316.5E-6112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000316.5E-6121137IPR000047Helix-turn-helix motif
PfamPF021838.1E-17141183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDPGRVVFDS GVARRACPGG AQMLLFGGGG SANSGGFFRG VPAAVLGMDE SRSSSSAAGA  60
GAKRPFFTTH EELLEEEYYD EQAPEKKRRL TAEQVQMLER SFEEENKLEP ERKTELARRL  120
GMAPRQVAVW FQNRRARWKT KQLEHDFDRL KAAYDALAAD HHALLSDNDR LRAQVISLTE  180
KLQDKETSPS SATITTAAQE VDQPDEHTEA ASTTGFATVD GALAAPPPGH QQPPHKDDLV  240
SSGGTNDDGD GGAAVVVFDV TEGANDRLSC ESAYFADAAE AYERDCAGHY ALSSEEEDGG  300
AVSDEGCSFD LPDAAAAAAA MFGAAGVVHH DAADDEEAQL GSWTAWFWS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.325060.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329858430.0
Expression AtlasQ6ZA74-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g32080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g32080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1015690.0AK101569.1 Oryza sativa Japonica Group cDNA clone:J033050G15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650258.10.0PREDICTED: homeobox-leucine zipper protein HOX5
SwissprotQ6ZA740.0HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
TrEMBLA0A0E0QJ090.0A0A0E0QJ09_ORYRU; Uncharacterized protein
STRINGLOC_Os08g32080.10.0(Oryza sativa Japonica Group)
STRINGLOC_Os08g32085.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-44homeobox 1
Publications ? help Back to Top
  1. Meijer AH,de Kam RJ,d'Erfurth I,Shen W,Hoge JH
    HD-Zip proteins of families I and II from rice: interactions and functional properties.
    Mol. Gen. Genet., 2000. 263(1): p. 12-21
    [PMID:10732669]
  2. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]