PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g31080.1
Common NameOSJNBa0086F04.28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 457aa    MW: 48653.4 Da    PI: 4.4849
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g31080.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.13.4e-3987185199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCaaCk++rrkC++dC++apyfpa+q+++f n+h+lFG+sn+lk+l++l++e  +dam++l+y+Ae+ra+dPv G+++vi +l++qle   ae
  LOC_Os08g31080.1  87 ACAACKYQRRKCNPDCPMAPYFPADQQRRFLNAHRLFGVSNILKTLRHLKPELCDDAMRTLIYQAEMRAHDPVGGCCRVICDLERQLELDTAE 179
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       l+++ +
  LOC_Os08g31080.1 180 LNTVLH 185
                       *98866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.01786187IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-3787183IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MTSTTTITTT NTTTTTTNNN NNPVSTTTTT TASHQRQSLP VAARPPHSSG SGSGSGGSHR  60
GASGGGSGGG GGGGGGGGGG GGGTNQACAA CKYQRRKCNP DCPMAPYFPA DQQRRFLNAH  120
RLFGVSNILK TLRHLKPELC DDAMRTLIYQ AEMRAHDPVG GCCRVICDLE RQLELDTAEL  180
NTVLHHLAMC RQAAAAGASG SVAAALPAGV LDDACADLDV TSSNQPLLLS AEHEVVDALY  240
ANQEADAAIL HADGHHNQDE SQREHHHGQP QQLYDYFYYD STAGDDVSSK PHLDINVDGM  300
QHFDFDTNYD AEHKVELTSD HQMPVGVDEH NQIDDKGFEI KSGPSLVDVF DLRQEEEQVQ  360
TVDVNTDIEV KEMVDMNADI DVKTMVDENS NIDIIKTMVD VNADIVDVVK TVVDVNGDIG  420
VKEELPELDN GKIIAGDATQ MAESSHCRLG LGVSSF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16683SGGGGGGGGGGGGGGGGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.715370.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160136020.0
Expression AtlasQ6Z284-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g31080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g31080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0053880.0AP005388.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0086F04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649280.10.0PREDICTED: uncharacterized protein LOC9266602
TrEMBLA0A0E0QIQ50.0A0A0E0QIQ5_ORYRU; Uncharacterized protein
TrEMBLQ6Z2840.0Q6Z284_ORYSJ; Putative lateral organ boundaries (LOB) domain protein
STRINGLOC_Os08g31080.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55241021
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.15e-37LOB domain-containing protein 22