PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g29500.1
Common NameLOC4345446, Os08g0383700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 297aa    MW: 33684.8 Da    PI: 5.3059
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g29500.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB71.71.3e-221195387
             NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
                      ++d  lP + + +i+k++lP + ++++da++++ ec +efi +++se+++ c re++kti+++ +l al +lGf +y+e++++  
  LOC_Os08g29500.1 11 KEDVSLPKSTMFKIIKEMLPPDVRVARDAQDLLVECCVEFINLLSSESNEVCSREDKKTIAPEHVLRALQDLGFREYIEEVQAAY 95
                      67999**************************************************************************998654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.3E-388140IPR009072Histone-fold
SuperFamilySSF471131.57E-3312140IPR009072Histone-fold
PfamPF008082.6E-191579IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDPMDIVGKS KEDVSLPKST MFKIIKEMLP PDVRVARDAQ DLLVECCVEF INLLSSESNE  60
VCSREDKKTI APEHVLRALQ DLGFREYIEE VQAAYEHHKH DTLDSPKASK FTGVEMTEEQ  120
AVAEQQRMFA EARARMNNGA AKPKEPEPEA QQQTQQPPQP QLHPQPQQPL QPQLQLHPQP  180
QQQPSQLHPQ QLLHPQSQQT PQPQPQVHPQ PQQPPQLQPQ PQLLQQPQLP QQLQPQSQLP  240
PQPQQPPQLQ LQSQLHPQPQ QPPQLQPQPQ LHQQPQPQAE LQSQSQPQTE HGLDSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B1e-321213312133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.156170.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184816190.0
Expression AtlasQ0J603-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g29500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g29500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8301300.0CT830130.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA058B22, full insert sequence.
GenBankAF4649020.0AF464902.1 Oryza sativa repressor protein (Dr1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650908.10.0PREDICTED: protein Dr1 homolog isoform X2
SwissprotP495922e-81NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A0E0AIJ20.0A0A0E0AIJ2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IB740.0A0A0E0IB74_ORYNI; Uncharacterized protein
TrEMBLQ0J6030.0Q0J603_ORYSJ; Os08g0383700 protein
TrEMBLQ8W0W90.0Q8W0W9_ORYSA; Repressor protein
STRINGBGIOSGA028589-PA1e-109(Oryza sativa Indica Group)
STRINGBRADI3G34930.11e-109(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-80nuclear factor Y, subunit B13