PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g27740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 834aa    MW: 94958.5 Da    PI: 8.0951
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g27740.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR157.25.5e-18210333290
              FAR1   2 fYneYAkevGFsvrkskskks.......krngeitkrtfvCskegkreeekkk.............................tekerrtraet 58 
                        Yn+YA+++GF +r+++s++s       k+ ++ ++r+f C    k+e+++k+                              e +r++ ++ 
  LOC_Os08g27740.1 210 VYNAYAYKLGFGTRIASSRNSqassgekKHRRNLIRREFECVHARKPENTTKDsaggssfiseenkenppllegnkkkapllVEGKRKRPKVA 302
                       7****************99999999998888899***************99999***************************98999999999* PP

              FAR1  59 rtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       + +Cka++ v ++ d+kw+v+ ++ +H+H+++
  LOC_Os08g27740.1 303 KYDCKAHMAVGLR-DNKWRVIAFQPKHTHPMV 333
                       *************.9**************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-15210333IPR004330FAR1 DNA binding domain
PfamPF105516.2E-31441533IPR018289MULE transposase domain
PROSITE profilePS5096611.115709745IPR007527Zinc finger, SWIM-type
PfamPF044344.2E-6709743IPR007527Zinc finger, SWIM-type
SMARTSM005753.4E-5720747IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MATKSGVNDL NTIKVSTLAR FRRCVGVGED GKHEGRSSRS DWRCAATGDS LQRRRPYPSR  60
PYPPRAGEAC NNADVPPHHT QSPPCNFATD AMAHLIHQVE RDFSPSSSSA NRGTTPMHNA  120
TNLIDVQAPS SSGGFLDVLL SKSSGHETDL VVDVESVDNT DVAAVTVEID EQLDEDASEN  180
DEKEKDVVCS PPIVPYIGME FDIVEEARNV YNAYAYKLGF GTRIASSRNS QASSGEKKHR  240
RNLIRREFEC VHARKPENTT KDSAGGSSFI SEENKENPPL LEGNKKKAPL LVEGKRKRPK  300
VAKYDCKAHM AVGLRDNKWR VIAFQPKHTH PMVKRLGRRR YYRSHRHISN EDYEFLKTLH  360
YRNIATSQIL ALLGDLHGGV RNLTFIAKDV SNLRTKLRQQ VSLKDVAMTI DYFQYDEDNV  420
LKALFWVDGR TRKLYQSYKD CVFFDTTFMT NRYNMPFAPI VGINNHLQTI LLGCALICDE  480
TTETFIWVFE TWMQAMNGQK VGSVMTVRDK AMRAAIKKVF PGTIHRCCLW HVTTKADQQL  540
LPVYTSKKGF REALYRCIYD SETIDQFLSD WQKMVDEYDL HGNQTLNNLW ETKEMWAPVY  600
FNTSFFPFTG TTGRSEGLNG LFKLFVHPQD SVWIFVKQYE HIIETRLDRE DREGYRVETT  660
EPRMYSRSLI EKQASQFYTT RLDAEKTQEV PDIIYNVMPS DIERTGKKYR VTVDAAHSTY  720
SCSCHKFERD GLLCSHILRV MAVLNIHEIP SKYLLKWWSE QATLQIRDEY NGPAPSIGVP  780
ATSKLRFNAL CRAMTSLASD ACVNEEKYLI VSAGIQNLHA MVATPHTVET QHQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g27740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g27740
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0058170.0AP005817.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1118_F01.
GenBankAP0039130.0AP003913.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1484_G09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460160.10.0hypothetical protein SORBIDRAFT_02g023634, partial
TrEMBLB8BA790.0B8BA79_ORYSI; Putative uncharacterized protein
STRINGLOC_Os08g27740.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1484922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-84FAR1-related sequence 5