PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g26880.1
Common NameLOC4345363, OsJ_27035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 181aa    MW: 20128.5 Da    PI: 8.6814
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g26880.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.92e-173696363
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                      +lkr rrk++NRe+A+rsR+RK++ ++ L+  v +L+ eN++L  +l++ ++ +a  +s++
  LOC_Os08g26880.1 36 DLKRKRRKESNRESAKRSRLRKQQHLDDLTSQVNQLKMENQQLTTTLNMVTQSCAFAESQN 96
                      79****************************************************9777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.0E-143190No hitNo description
SMARTSM003381.5E-173498IPR004827Basic-leucine zipper domain
PfamPF001705.7E-143695IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.2663688IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.19E-123791No hitNo description
CDDcd147028.21E-223990No hitNo description
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MTLSGGTLSS GITSGSSHGT RSSGSEGDIQ LQVQMDLKRK RRKESNRESA KRSRLRKQQH  60
LDDLTSQVNQ LKMENQQLTT TLNMVTQSCA FAESQNSVLR TQMMELDSRL SALREIIFYM  120
NNGNQSPSNP TIAATTYPST TTMTAATTGH YDYYDVFTAN AWGSGMQMMQ QPIDQFLYQC  180
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13742KRKRRK
23843RKRRKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.538800.0callus| flower| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329857890.0
Expression AtlasA3BSC5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g26880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g26880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0055200.0AP005520.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0426E02.
GenBankAK1005800.0AK100580.1 Oryza sativa Japonica Group cDNA clone:J023105M12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015651067.11e-133PREDICTED: ocs element-binding factor 1
TrEMBLA0A0E0QHY41e-133A0A0E0QHY4_ORYRU; Uncharacterized protein
TrEMBLA3BSC51e-133A3BSC5_ORYSJ; Uncharacterized protein
STRINGLOC_Os08g26880.11e-132(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1070849
MonocotsOGMP37403276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-14basic leucine-zipper 44