PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g25820.1
Common NameLOC9267033, Os08g0346500, OSNPB_080346500, P0404D10.4, P0410E11.135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 308aa    MW: 33379.1 Da    PI: 6.1825
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g25820.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.8e-334599155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      ++rlrWt+eLH+rFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  LOC_Os08g25820.1 45 RQRLRWTNELHDRFVEAVTQLGGPDRATPKGVLRIMGVPGLTIYHVKSHLQKYRL 99
                      58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.75742102IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-3244100IPR009057Homeodomain-like
SuperFamilySSF466893.58E-184499IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-2646100IPR006447Myb domain, plants
PfamPF002498.1E-94798IPR001005SANT/Myb domain
PfamPF143791.5E-23131177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MYQPNPISSS GQTHGNPTAH EQMELGNNAI VPSNGGNNNP NMAARQRLRW TNELHDRFVE  60
AVTQLGGPDR ATPKGVLRIM GVPGLTIYHV KSHLQKYRLA KYIPDPSADD NKDEDKDPGN  120
LLSALEGSSG MQISEALKLQ MEVQKRLHEQ LEVQRQLQLR IEAQGKYLQK IIEEQQRVIG  180
AGASRATSSE QLPDSEKTNP PTPVPISESP VQGAPHSKNS QSQVEPTKSP SHDDALPCGE  240
PLTPDSSCRP GSPTLSPKHE RAAKRQRGSD AGDVTAFADG EFVLPPGIFE SSTGSEFQEC  300
SMPYSGH*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ84QT0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g25820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g25820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0044590.0AP004459.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0410E11.
GenBankAP0043960.0AP004396.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0404D10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648505.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN56e-50PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0D3GZB60.0A0A0D3GZB6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0QHS20.0A0A0E0QHS2_ORYRU; Uncharacterized protein
TrEMBLI1QHZ50.0I1QHZ5_ORYGL; Uncharacterized protein
TrEMBLQ84QT00.0Q84QT0_ORYSJ; Os08g0346500 protein
STRINGLOC_Os08g25820.10.0(Oryza sativa Japonica Group)
STRINGORGLA08G0104600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP22203896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-77G2-like family protein