PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g25799.1
Common NameLOC4345340, Os08g0346400, OsJ_26993, OSNPB_080346400, P0404D10.1-1, P0410E11.132-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 247aa    MW: 26888.5 Da    PI: 8.4777
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g25799.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-333488155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprlrWt +LH+rFv+av+qLGG++kAtPkti+++m+vkgLtl h+kSHLQkYRl
  LOC_Os08g25799.1 34 KPRLRWTADLHDRFVDAVAQLGGPDKATPKTIMRTMGVKGLTLFHLKSHLQKYRL 88
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.9183191IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-323189IPR009057Homeodomain-like
SuperFamilySSF466891.18E-163490IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-243489IPR006447Myb domain, plants
PfamPF002493.6E-83687IPR001005SANT/Myb domain
PfamPF143795.9E-21129174IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MFPGLIHHHR LLDADVGGGG GGSSAGLVLT ADPKPRLRWT ADLHDRFVDA VAQLGGPDKA  60
TPKTIMRTMG VKGLTLFHLK SHLQKYRLGK QSGKEMAEQS KDASYILGAQ SGTNLSPTVP  120
TPDLKESQEL KEALRAQMEV QRKLHEQVEV QRHVQIRMEA YQNYIDTLLE KACNIVSEQL  180
NGFSISDHDL TSAGVMLSSS DTLSPSIFHQ LSVSSISLHS PGGKSSPFAA DADLFFQKAP  240
EKRKSY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.154640.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ84QT1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g25799.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g25799
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8342320.0CT834232.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN036L13, full insert sequence.
GenBankAK1038730.0AK103873.1 Oryza sativa Japonica Group cDNA clone:J033149L11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650961.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK53e-56APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0E0AUD50.0A0A0E0AUD5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IGX50.0A0A0E0IGX5_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QHR90.0A0A0E0QHR9_ORYRU; Uncharacterized protein
TrEMBLQ84QT10.0Q84QT1_ORYSJ; Os08g0346400 protein
STRINGLOC_Os08g25799.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP34273873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.16e-67G2-like family protein