PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g19650.2
Common NameOJ1705_A03.8, Os08g0292900, OSH45, OSJNBb0075O18.121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 272aa    MW: 30288.1 Da    PI: 6.5156
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g19650.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.35.4e-082202532154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp++e++++L +++gL+ +q+ +WF N+R +
  LOC_Os08g19650.2 220 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 253
                       569*****************************87 PP

2ELK27.19.6e-10174195122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELKh+L+++Y+++L+++++E++
  LOC_Os08g19650.2 174 ELKHELKQGYKEKLIDIREEIL 195
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.3E-201054IPR005540KNOX1
PfamPF037904.4E-181253IPR005540KNOX1
SMARTSM012565.5E-2763119IPR005541KNOX2
PfamPF037918.7E-1971118IPR005541KNOX2
PfamPF037891.8E-4174195IPR005539ELK domain
SMARTSM011880.004174195IPR005539ELK domain
PROSITE profilePS5121310.039174194IPR005539ELK domain
PROSITE profilePS5007111.742194257IPR001356Homeobox domain
SuperFamilySSF466892.27E-16196261IPR009057Homeodomain-like
SMARTSM003894.8E-11196261IPR001356Homeobox domain
CDDcd000867.63E-12197258No hitNo description
Gene3DG3DSA:1.10.10.603.4E-25201258IPR009057Homeodomain-like
PfamPF059206.8E-18214253IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGGGGEADAA RCKAEILAHP LYEQLLSAHV ACLRIATPVD QLPRIDAQLA QSQGVVAKYS  60
ALAAAAAGDD GRELDQFMTH YVLLLCSFKE QLQQHVRVHA MEAVMACWEL EQNLQSLTGA  120
SPGEGTGATM SDGEDDQADS EANMYDPSLD GADNMGFGLP TESERSLMER VRQELKHELK  180
QGYKEKLIDI REEILRKRRA GKLPGDTTST LKAWWQSHAK WPYPTEEDKA RLVQETGLQL  240
KQINNWFINQ RKRNWHSNPS SSTSVKTKRK R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-13197261872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1250270RKRNWHSNPSSSTSVKTKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.59920.0flower| leaf| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379883080.0
Expression AtlasQ0J6N4-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Isoforms 1 and 2 are expressed in roots, stems, shoot meristem, leaf blades, leaf sheaths and flowers. Isoform 3 is expressed in stems, shoot meristem, rachis, leaf blades and leaf sheaths. {ECO:0000269|PubMed:7599652}.
Functional Description ? help Back to Top
Source Description
UniProtIsoform 3 acts as trancription activator, but isoforms 1 and 2 do not. {ECO:0000269|PubMed:7599652}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g19650.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g19650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1116450.0AK111645.1 Oryza sativa Japonica Group cDNA clone:J013132C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650701.10.0PREDICTED: homeobox protein knotted-1-like 13 isoform X2
RefseqXP_015650702.10.0PREDICTED: homeobox protein knotted-1-like 13 isoform X3
SwissprotQ0J6N40.0KNOSD_ORYSJ; Homeobox protein knotted-1-like 13
TrEMBLA0A0E0ISF30.0A0A0E0ISF3_ORYNI; Uncharacterized protein
STRINGLOC_Os08g19650.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-157KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]
  2. Tamaoki M, et al.
    Alternative RNA products from a rice homeobox gene.
    Plant J., 1995. 7(6): p. 927-38
    [PMID:7599652]