PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g19590.2
Common NameOs08g0292000, OSNPB_080292000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 787aa    MW: 86649.1 Da    PI: 8.1511
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g19590.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-1963118257
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       r+ + +t +q e+L+++F+++++p++++ ++LAk+l++te+q+k+WFqN R+k+kk
  LOC_Os08g19590.2  63 RRYQLLTMQQKETLNRAFQSCPNPDRNDLKKLAKELNMTETQIKYWFQNCRTKMKK 118
                       6677899************************************************8 PP

2START1081.5e-342694986204
                       HHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
             START   6 aaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                       ++++l+ k +++ p+W         es+n++e+l k  +  +     +++ + r++++v + +++lv++lld + +W e ++    +a t++ 
  LOC_Os08g19590.2 269 ENESLLVKKKENGPLWLPHMdilgvESLNYQEYLAKSRTI-GqkpvdFKVVVTRDTAIVNGSCVDLVKSLLDAN-RWRELFPgivaSANTTKI 359
                       45666677789999999888899999********999553.3589999**************************.******99999******* PP

                       ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..........-TTSEE...-EESSEEEEEEEEC CS
             START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.........sssvvR...aellpSgiliepks 158
                       is+g      g lqlm aelq++sp vp  d++f+R++ q g g w +vdvS+d   + ++         ss  +R   ++llpSg++ie+++
  LOC_Os08g19590.2 360 ISTGpsnlhdGLLQLMRAELQVMSPEVPvCDVTFLRQSVQFGSGLWCVVDVSIDTILPGESktaqssvqtSSTAARrmeVRLLPSGCVIEEME 452
                       *****************************************************97666655543222333222233445999*********** PP

                       TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                       ng+skvtw+ h+ +++r ++ l++sl++s  a ga +wva lqr+ 
  LOC_Os08g19590.2 453 NGYSKVTWMVHAAYDERAVPVLYHSLLRSAKALGACRWVASLQRHS 498
                       ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1549101IPR009057Homeodomain-like
SuperFamilySSF466898.77E-1851120IPR009057Homeodomain-like
PROSITE profilePS5007115.74259119IPR001356Homeobox domain
SMARTSM003891.9E-1761123IPR001356Homeobox domain
CDDcd000864.20E-1862118No hitNo description
PfamPF000464.1E-1763118IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-4102144IPR009057Homeodomain-like
CDDcd146863.67E-4110147No hitNo description
PROSITE profilePS5084825.265245503IPR002913START domain
CDDcd088755.81E-93249499No hitNo description
SuperFamilySSF559612.2E-19249498No hitNo description
SMARTSM002342.8E-12254500IPR002913START domain
PfamPF018522.2E-27272498IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MNGELKLMAS YVSKLKFILQ KDQQQEPHTA NLLVLLGSSN QDKRNGLSQG ENRMDTCTRK  60
KPRRYQLLTM QQKETLNRAF QSCPNPDRND LKKLAKELNM TETQIKYWFQ NCRTKMKKFK  120
NNEERKLLQK ENEELKKENA ELRNRMKNST CRACDLPLFH IDCRHWENPM LNKGNHGVTS  180
NLIPQAVSSL LPSSSGFVAS GSNLSSNAVL MPVSAMPSSV LQPAPAVSGA NFPILHNLSA  240
NANDGYTEKN VLLDLANRAM EEFFSLMKEN ESLLVKKKEN GPLWLPHMDI LGVESLNYQE  300
YLAKSRTIGQ KPVDFKVVVT RDTAIVNGSC VDLVKSLLDA NRWRELFPGI VASANTTKII  360
STGPSNLHDG LLQLMRAELQ VMSPEVPVCD VTFLRQSVQF GSGLWCVVDV SIDTILPGES  420
KTAQSSVQTS STAARRMEVR LLPSGCVIEE MENGYSKVTW MVHAAYDERA VPVLYHSLLR  480
SAKALGACRW VASLQRHSQF LSGLHKYIFC PDSTMTEVVM RRKVLYLVKQ MTSSFTGLFA  540
SMSKATLQDG DDTHFAHQIV GGATGEPAGL LLSATTTIWL PGVNPRHVYD HLRDEQCHGE  600
WRCLLGEQLH QGNALPYGAP LNGETVPEFY RMVNGLHEGH AISLISPREM GGNISNTLLL  660
QEARTDLSGS LIVYARTDVN TVHSIMNSGL NPATVFLVSS GCAILPDCLE SFPLHPAATA  720
DQAGTSSAAI ASRSETGGSF VTVTYQMFFS SQGGAAPASS SIHQGRDALK KATDIFKVVL  780
DTLTVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.536570.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329856500.0
Expression AtlasA0A0N7KPL6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g19590.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g19590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1004410.0AK100441.1 Oryza sativa Japonica Group cDNA clone:J023089M04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650915.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X1
RefseqXP_015650916.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X1
TrEMBLA0A0N7KPL60.0A0A0N7KPL6_ORYSJ; Os08g0292000 protein (Fragment)
TrEMBLQ7EYP60.0Q7EYP6_ORYSJ; Os08g0292000 protein
STRINGLOC_Os08g19590.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.15e-91protodermal factor 2