PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g17400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 551aa    MW: 59781.9 Da    PI: 6.707
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g17400.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY955.2e-30228284259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        Dg+nWrKYGqK+vk+se++rsYYrCt ++C +kkkve++  d++vvei+Y+g+Hnhe
  LOC_Os08g17400.1 228 GDGFNWRKYGQKQVKSSENSRSYYRCTNSNCLAKKKVEHCP-DGRVVEIIYRGTHNHE 284
                       6****************************************.***************8 PP

2WRKY100.51e-31396453259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vkg+++prsYYrCt+ gCpv+k+ve++ +d + +++tYeg+Hnh+
  LOC_Os08g17400.1 396 SDGYRWRKYGQKIVKGNPNPRSYYRCTHDGCPVRKHVEKAPDDDNNIVVTYEGKHNHD 453
                       7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-26220286IPR003657WRKY domain
SuperFamilySSF1182907.32E-24222286IPR003657WRKY domain
PROSITE profilePS5081121.746222286IPR003657WRKY domain
SMARTSM007749.4E-33227285IPR003657WRKY domain
PfamPF031069.8E-23229284IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.4E-31389455IPR003657WRKY domain
SuperFamilySSF1182901.57E-27390455IPR003657WRKY domain
PROSITE profilePS5081132.799390455IPR003657WRKY domain
SMARTSM007742.0E-36395454IPR003657WRKY domain
PfamPF031064.1E-26397453IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MPDGYPAAPP GMERPAPEAA AAAAEPPGAK AEEEEEGPKD VGVKGTGKEK ETEKVEAEKE  60
MEGKGKGKES MEVEEGKEKE GKGKAKEKEK ETKVKVKEEG GEEKEKGKVE VVEAKRRPAG  120
VGAETPILAV PMVAVPCFLA SPAFAGHFSM SHQAALASVT AQAQIQLQSP TTPYSEGLPS  180
PFPITPKAVM PLQRSPSGTE GSVRRSVLEK SASFQSRPHN HVSVNMVGDG FNWRKYGQKQ  240
VKSSENSRSY YRCTNSNCLA KKKVEHCPDG RVVEIIYRGT HNHEPPQKTR FVKERVAHIT  300
ASSGDDETLG LVNNEIIESP SPGCKLEPGA VSEASEQQLF CSSDCEGDAG NKSEDDHPST  360
EPQPKRSRII ETSTPLTPVL RTVREQKIIV QAGKTSDGYR WRKYGQKIVK GNPNPRSYYR  420
CTHDGCPVRK HVEKAPDDDN NIVVTYEGKH NHDQPFRNNS ESKDGPVPMI IPAETTSEQP  480
STMTSTSEQK QPISLLKDGG DEPMKGKTSE IGGEKAVESA QTLISIKTNP DDMKNTLLKD  540
TSAVVPVQNN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-253974551977Probable WRKY transcription factor 4
2lex_A2e-253974551977Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.575950.0callus| flower| leaf| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO833202560.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g17400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g17400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2981860.0DQ298186.1 Oryza sativa (japonica cultivar-group) WRKY transcription factor 82 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650462.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
TrEMBLB9G0120.0B9G012_ORYSJ; Uncharacterized protein
STRINGLOC_Os08g17400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1449844
MonocotsOGMP58203455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.14e-64WRKY DNA-binding protein 4