PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g17100.1
Common NameOSJNBa0053M06.27, OSJNBa0091D16.46
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 90aa    MW: 9830.45 Da    PI: 4.1264
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g17100.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix27.21e-084279138
          trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkm 38
                      rW +q +l+L+++r em++ l+++ l+++ Wee+s+ +
  LOC_Os08g17100.1 42 RWLRQDTLELLTIRPEMDTVLQEATLNGAIWEEISRIC 79
                      8**********************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MPLTLLCLAF SPFAWPPSLP PPPQTPDAIA GCKNKAEAGA GRWLRQDTLE LLTIRPEMDT  60
VLQEATLNGA IWEEISRICD VFFVGDFVM*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6YWY9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g17100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g17100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149641e-64AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0057311e-64AP005731.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0091D16.
GenBankAP0051631e-64AP005163.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0053M06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ6YWY97e-60Q6YWY9_ORYSJ; Uncharacterized protein
STRINGLOC_Os08g17100.12e-59(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-10Trihelix family protein