PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g16370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 510aa    MW: 57932 Da    PI: 8.4151
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g16370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR133.41.5e-1060116159
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetr 59 
                       kfY++Y ++vGFsvr+ ++kk   n+ + ++ f+Cs++g ++++ ++ ++ +++r++++
  LOC_Os08g16370.1  60 KFYKSYVHTVGFSVRIGQQKKL--NEVVQCKCFMCSRQGWKSKKGNEISDPSKKRPNEK 116
                       6****************99988..999*****************999665555555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.3E-760114IPR004330FAR1 DNA binding domain
PfamPF105511.0E-16114170IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MDAHSDDEIA IPLSDDDERF NTPKKKPSIP LNCSSFTPDC DEEITPAVGM KFEDIEAVEK  60
FYKSYVHTVG FSVRIGQQKK LNEVVQCKCF MCSRQGWKSK KGNEISDPSK KRPNEKIESY  120
IWLFKTFLHA MGGKAPTLII TDEDASMKAA INQVLRNTVH RLCMWHIMKK ISDKIGPLWR  180
ENKGNEWLSK SYDIRESWIP AYFMDISLAG ILRSTSRSKS LNSFFNRFIH LFEKLREKIV  240
AARDIVVLKT WENVYNDYGN LLEEIAIDSS EMAVRKKISA ACNKFEDLIQ KAKHSAEAID  300
FLTSSVLSLE APLDQMVAGG RQTRQEEFES FLGCNIPTEV DILPTTDTHS RGRIKRIRSK  360
ENKNQGSNTS KYQGGKERIP RLCKICKEMV FHDSRNCPNK TSIRLQGFER YYIQFNLDEH  420
FYHQWRPTTR GKDDDLFTAR FVAATNGDED AEEMQRYRIA RMATKEAEGA AGGVATMVQP  480
WVTGCGVVFG PSPRPPCTSA SSSLTCKGT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g16370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g16370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0061580.0AP006158.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:B1127C04.
GenBankAP0056970.0AP005697.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBb0005C03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751165.13e-85PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLQ0J6V20.0Q0J6V2_ORYSJ; Os08g0263600 protein
STRINGLOC_Os08g16370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.13e-22FAR1 family protein