PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g15050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 304aa    MW: 29943.1 Da    PI: 6.5002
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g15050.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box193e-061759542
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                       C  ++   ++ +C  +   lC  C  + H        H++vpl
  LOC_Os08g15050.1 17 ACGVCGGA-ATVYCAADAAALCVPCDAAVHAAnplasrHDRVPL 59
                      6******9.*********************66899999999986 PP

2CCT66.66.8e-23192235144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Re++++RY+eKrk+RkF+K+irY+sRKa+Ae RpR+KGrFvk+a
  LOC_Os08g15050.1 192 REERVRRYREKRKNRKFQKTIRYASRKAYAEARPRIKGRFVKRA 235
                       9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-91359IPR000315B-box-type zinc finger
PROSITE patternPS0019701321IPR0060582Fe-2S ferredoxin, iron-sulphur binding site
PROSITE profilePS501199.3431859IPR000315B-box-type zinc finger
CDDcd000211.93E-62659No hitNo description
PfamPF062032.0E-17192234IPR010402CCT domain
PROSITE profilePS5101716.479192234IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0051537Molecular Function2 iron, 2 sulfur cluster binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MMASDGSASP ASCGGAACGV CGGAATVYCA ADAAALCVPC DAAVHAANPL ASRHDRVPLA  60
VAMAAASSGV YDHLFAPDDD AASSWAAAAA AGAAVQGQGQ GSPNDSSSSF TNDSAGGGGG  120
GGAERSLFDL LSDVDIMSCG GGGLASSFDG AAAPPLWLHP GQLAALTPWS PADSVVVPTS  180
AAGAVAAAAA AREERVRRYR EKRKNRKFQK TIRYASRKAY AEARPRIKGR FVKRATTAAA  240
SSSSDDDSTA AAGVSGAGGA GAAATKEAKF WLSFSDDGRA DGVGFYMDST TAATAAYGVV  300
PTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.164220.0leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166340000.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g15050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g15050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0057990.0AP005799.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0012K14.
GenBankAP0054950.0AP005495.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBb0003H03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648718.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0E0QGB30.0A0A0E0QGB3_ORYRU; Uncharacterized protein
STRINGLOC_Os08g15050.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1297945
MonocotsOGMP130662224
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.15e-10CONSTANS-like 5