PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g15020.1
Common NameLOC4345070, Os08g0248700, OSJNBb0003H03.23, OSNPB_080248700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 317aa    MW: 34397.2 Da    PI: 6.3143
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g15020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.1e-161462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd  l+++++++G+g +W + ++++g++R++k+c++rw++yl
  LOC_Os08g15020.1 14 KGPWSPEEDAMLKNYIEEHGTGgNWIALPHKIGLKRCGKSCRLRWLNYL 62
                      79*********************************************97 PP

2Myb_DNA-binding39.71.2e-1269111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T+eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  LOC_Os08g15020.1  69 GDFTPEEDSIICSLYISIGSR-WSIIAAQLP-GRTDNDVKNYWNT 111
                       789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.796962IPR017930Myb domain
SuperFamilySSF466896.13E-2712109IPR009057Homeodomain-like
SMARTSM007174.0E-131364IPR001005SANT/Myb domain
PfamPF002492.2E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-241569IPR009057Homeodomain-like
CDDcd001676.91E-101662No hitNo description
PROSITE profilePS5129421.49763117IPR017930Myb domain
SMARTSM007171.7E-1167115IPR001005SANT/Myb domain
PfamPF002495.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2370117IPR009057Homeodomain-like
CDDcd001677.18E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWSPE EDAMLKNYIE EHGTGGNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTPEEDSIIC SLYISIGSRW SIIAAQLPGR TDNDVKNYWN TKLKKRLLGR  120
RKDRGGGHHH RSQSTADDLP AGGDGGMNDG GGGGGERSLS ASAMERIQLC MQLQELQNPL  180
SIHHNPLLSH QWPSKATIDD QNHNNVTVAE HGMSSSVSDH HRLDGQQLES GAGAAAMQQA  240
SPSSGGENSN VVVAIEAELQ ELLYAGGGAI VDGGAPPQGD VDWWSYDQGK QSPVTCWDFT  300
PETSSIFQDY ATVYDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141177108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.498240.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379884510.0
Expression AtlasQ6Z0A5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g15020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g15020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117880.0AK111788.1 Oryza sativa Japonica Group cDNA clone:J023093J22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648313.10.0PREDICTED: transcription factor MYB21
SwissprotQ9FKL22e-86MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0E0I9870.0A0A0E0I987_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QGB00.0A0A0E0QGB0_ORYRU; Uncharacterized protein
TrEMBLQ6Z0A50.0Q6Z0A5_ORYSJ; Os08g0248700 protein
STRINGLOC_Os08g15020.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-78myb domain protein 36