PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g14400.1
Common NameLOC4345042, Os08g0242400, OsJ_025487, OSJNBa0087F21.36, WOX10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 285aa    MW: 30271.6 Da    PI: 6.8477
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g14400.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.61.4e-1541101257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       r+R+++++eq+ +Le+ F++   +p ++e +++ + l     + +++V++WFqNrR + ++
  LOC_Os08g14400.1  41 RSRWAPKPEQILILESIFNSgMVNPAKDETARIRRLLerfgAVRDANVFYWFQNRRSRSRR 101
                       89*****************99*************************************997 PP

2Wus_type_Homeobox104.76e-3440102264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        ar+RW+P+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++
   LOC_Os08g14400.1  40 ARSRWAPKPEQILILESIFNSGMVNPAKDETARIRRLLERFGAVRDANVFYWFQNRRSRSRRR 102
                        689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.64E-1337108IPR009057Homeodomain-like
PROSITE profilePS5007111.67737102IPR001356Homeobox domain
SMARTSM003899.9E-639106IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-840101IPR009057Homeodomain-like
PfamPF000462.4E-1341101IPR001356Homeobox domain
Gene3DG3DSA:1.20.5.6008.6E-4102138IPR012897Potassium channel, voltage dependent, Kv1.4, tandem inactivation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006813Biological Processpotassium ion transport
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005249Molecular Functionvoltage-gated potassium channel activity
GO:0030955Molecular Functionpotassium ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MDRTATASWE VMSRRGEQQQ QLMMQAPASH NGGSGGGEPA RSRWAPKPEQ ILILESIFNS  60
GMVNPAKDET ARIRRLLERF GAVRDANVFY WFQNRRSRSR RRARQLQQAC GAALHQLPSA  120
AAAAGAGGGG DYYHHHHQPS SSPFLMHGGG GGGVVTSTTA APAVAASGHF LADEVDGGGD  180
DDLFAISRQM GLMARHGGGD HHYSSYADSD ATQLSYQPTG TIQVFINGVA YDVPSGGALD  240
MAGTFGRDAM LVHSSGEVLP VDEHGVLINS LQMGECYYLV SKSI*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329925140.0
Expression AtlasQ6Z3L4-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g14400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g14400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1073050.0AK107305.1 Oryza sativa Japonica Group cDNA clone:002-126-D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649642.10.0PREDICTED: WUSCHEL-related homeobox 10
SwissprotQ6Z3L40.0WOX10_ORYSJ; WUSCHEL-related homeobox 10
TrEMBLA0A0E0QG600.0A0A0E0QG60_ORYRU; Uncharacterized protein
STRINGLOC_Os08g14400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP46971222
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.23e-49WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]
  2. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]