PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g09810.1
Common NameOs08g0198100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 873aa    MW: 98693.4 Da    PI: 6.3351
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g09810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY52.41e-1666121359
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       DgynWr  GqK v+g  + + YY C++a+C + k v rsa d+++ +++ +g+Hnh+
  LOC_Os08g09810.1  66 DGYNWRMCGQKLVQGGCHQKFYYECSQANCGAEKSVTRSA-DGQIKKTVCKGSHNHP 121
                       9***************************************.***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.7E-1662122IPR003657WRKY domain
SMARTSM007741.2E-1064122IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.6E-1564122IPR003657WRKY domain
PfamPF031065.2E-1566121IPR003657WRKY domain
PROSITE profilePS5081114.30966123IPR003657WRKY domain
PROSITE profilePS5080811.603239294IPR003656Zinc finger, BED-type
SMARTSM006141.3E-17239290IPR003656Zinc finger, BED-type
PfamPF028924.9E-8242286IPR003656Zinc finger, BED-type
SuperFamilySSF576671.67E-7242289No hitNo description
SuperFamilySSF530981.9E-52378862IPR012337Ribonuclease H-like domain
PfamPF143721.3E-20633731IPR025525hAT-like transposase, RNase-H fold
PfamPF056991.2E-21778860IPR008906HAT, C-terminal dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MENNQSGQAQ DGMADQRFRS WLTEQLNMQQ QNAGCSSNPA PAVMQMPALP SHTDYGGIYP  60
NPTEYDGYNW RMCGQKLVQG GCHQKFYYEC SQANCGAEKS VTRSADGQIK KTVCKGSHNH  120
PRSSERVFGD GSATLDAILV GEILQAAGVI RPSVAMPRNE EEDGLQSGSS DSGDDDASEA  180
RAAGDDNAIR HVPAAAAQDT TAHNTIDVDV LGNSSQQLMG SFLTASQPLD SFLSSEKRKS  240
KSKVWEDFTA VFSGGKVQSA ECKHCKKCLS GKTSGGTSHL RRHLKICPAQ FRTTRLQQEG  300
SSSILDSSAA NNRKFDQETS LELLIRGLVS NHCSYLVPSS ANFRQFLVAI CPDYNMVPQA  360
AFEEKFLSFF HNEKMKLKEK IELTPGGVFL SVTKQYVEFK TFVCITVHFI DNEWKMNRKI  420
ISYGYGGYPD GADYYVGILT NWKSYLDIRD SLDYNFEEID SSLIKEAVQD WNLEHKLLGL  480
ALHKNFRNNV TSDLEECMAG EVQNYLLAKY KLLTVPCMID ALHDFFGYDV GNFVKEISKE  540
WFEYMTCSAL CLEKYKEILS RMHLNKPSLG SQKWHLTFYL FEAALQFNKE FPNPEEMDSQ  600
MDIRKPSPQR LEATKNFCDL VRPIYHAIDL LSRQYVTSNS HFHALWRVGI ALGESSRKLN  660
MKCIINVDYM KKRFDILWRK CYVWLSLAVF LDPRFKLRYL EQCFTQVSSS GCAKLFVLEV  720
RAKIYELFLQ YSCNVDWQTG ELLNHRSNDL QMDRHGNDSL HGTDKNDIEQ GSNGEFRELT  780
SYIEGELYPQ NDQFDILKWW KDNASTYPTL ARLARDILAI PGSAVSAEYA FNKTGERVIL  840
FNQKMSPEIV EALICTQDWI KSSETGDKNG GS*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154752000.0
Expression AtlasQ0J7F4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g09810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g09810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0054990.0AP005499.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0412D08.
GenBankAP0054160.0AP005416.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBb0094P23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649132.10.0PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like
RefseqXP_015649133.10.0PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like
TrEMBLQ0J7F40.0Q0J7F4_ORYSJ; Os08g0198100 protein
STRINGLOC_Os08g09810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1143025
MonocotsOGMP140321024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01080.11e-15WRKY DNA-binding protein 58