PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g09800.1
Common NameLOC4344884, Os08g0198000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 862aa    MW: 97370.3 Da    PI: 6.4311
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g09800.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY52.97.6e-1762117359
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       DgynWr  GqK+v+g  + + YY C++a+C + k v rsa d+++ +++ +g+Hnh+
  LOC_Os08g09800.1  62 DGYNWRICGQKVVQGGCHQKFYYECSQANCGAEKSVTRSA-DGQIKKTVCKGSHNHP 117
                       9***************************************.***************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-1651117IPR003657WRKY domain
SuperFamilySSF1182906.15E-1755118IPR003657WRKY domain
SMARTSM007747.8E-1160118IPR003657WRKY domain
PROSITE profilePS5081114.60762119IPR003657WRKY domain
PfamPF031061.7E-1462117IPR003657WRKY domain
PROSITE profilePS502318.887221288IPR000772Ricin B, lectin domain
PROSITE profilePS5080810.862227282IPR003656Zinc finger, BED-type
SMARTSM006142.6E-16227278IPR003656Zinc finger, BED-type
SuperFamilySSF576679.52E-7230276No hitNo description
PfamPF028921.4E-7230274IPR003656Zinc finger, BED-type
SuperFamilySSF530981.67E-60364424IPR012337Ribonuclease H-like domain
SuperFamilySSF530981.67E-60451851IPR012337Ribonuclease H-like domain
PfamPF143721.2E-20624720IPR025525hAT-like transposase, RNase-H fold
PfamPF056991.5E-21767849IPR008906HAT, C-terminal dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MENQSGQAQD GMADQRFRSW LTEQFNTQPY AGSSSNLAVM QMQVLPSHTT SQIIDTHPPE  60
YDGYNWRICG QKVVQGGCHQ KFYYECSQAN CGAEKSVTRS ADGQIKKTVC KGSHNHPLSS  120
ERVFGEGSAT LDAIPVGEIL QAAGVIRPSV AMPMNEEEDE LQSGLGDSEE DDANEARVDG  180
DGAAADANAI ERHGAAQDIT AQTATEVDVT GNGCQQRKNY CRSENRRSKS KVWKEFTAVL  240
SVGKIQSAEC KHCKKCLSGK SSGGTSHLRR HLKICPGQCR DTRIQQKWSS SRLDSSDANN  300
WEFDQETSLE LLTRALVSNL CPFSVTTSAN FRKFFAGICP TYNIVPQAAI EEKFLSIFQN  360
EKMKLKEEIA LKPGGVFLSV TRWAPECKQF LCFTVHFIDK EWKLNRKIIR FQFSGDEALE  420
AEHYVSILSN WKSFSNIRNA SYEYGTEKTN KALIKAAVQD WNLEKKLLGI ALPTNIGNEV  480
ILDLEETMTA AGQNFLLAKY KLLIVPCMIN ALHGLFGYTL ERYVLEASRE WFEYMTCSAI  540
RLEKYKEILL RLHLSQPSFG SQKWHLTYYL FEAALQFVKE FPNPDAAHLK MFLRKPFPER  600
LEATKNFCDL ARPIYHAIDV LSRQNVAFNS HFHVIWSLGT VLKESSKKIN IKRIIDIDDM  660
LKKFDNLWRK CYVWLSLAVV LDPRFKLRYL EQCFKQAFGT GAKLCILEVR GKIYELFLQY  720
SCNADQQSGE LVNHWNNDLQ MDRDGNDSLH GTDQNDIGQS ALGEFRELTL YLEGGLCPQN  780
EQFDILKWWK DNALTYPTLA RLARDILAIP GSAVSAESAF DETDERVSLF NRKLSPEIVE  840
ALICTQDWIK SSETGDENGG S*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154751980.0
Expression AtlasQ0J7F5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g09800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g09800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0054990.0AP005499.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0412D08.
GenBankAP0054160.0AP005416.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBb0094P23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649039.10.0PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like
TrEMBLQ0J7F50.0Q0J7F5_ORYSJ; Os08g0198000 protein
STRINGLOC_Os08g09800.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1143025
MonocotsOGMP140321024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01080.11e-14WRKY DNA-binding protein 58