PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g09690.2
Common NameLOC4344874, NF-Y18, Os08g0196700, OsHAP2A, OsJ_26347, OSNPB_080196700, P0035F08.38, P0412D08.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 187aa    MW: 20094.7 Da    PI: 10.2331
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g09690.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.86.7e-3282137258
         CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       ep+YVNa+Qy++Il+RRq+Rak+e+e+k  +k rkpylheSRh hAl+R+RgsgGrF
  LOC_Os08g09690.2  82 EPIYVNARQYHGILRRRQSRAKAESENKA-NKIRKPYLHESRHLHALKRARGSGGRF 137
                       8****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-3379140IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.96580140IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.9E-2782137IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.3E-2483105IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.3E-24114137IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MKPDGETQLR PTAAGHPDPG LGTSSAEYVA SLGPATAPVS YPYISTYYGG TYGAYSGQPL  60
VNAALMAMPP HSVPLVTDAV VEPIYVNARQ YHGILRRRQS RAKAESENKA NKIRKPYLHE  120
SRHLHALKRA RGSGGRFLNS KAVEGKQDTK SVDKKDGAVP SEEKRDKKLA NSIIKLENSS  180
PTTQPG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-2080141162NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.372380.0callus| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6Z065
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g09690.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g09690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ7314790.0HQ731479.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y18) mRNA, complete cds.
GenBankAB2880270.0AB288027.1 Oryza sativa Japonica Group OsHAP2A mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0599030.0AK059903.1 Oryza sativa Japonica Group cDNA clone:006-208-G09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648196.11e-134PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
SwissprotQ84JP11e-37NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
SwissprotQ8VY642e-37NFYA4_ARATH; Nuclear transcription factor Y subunit A-4
TrEMBLQ6Z0651e-134Q6Z065_ORYSJ; HAP2 subunit of HAP complex
STRINGLOC_Os08g09690.11e-134(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34720.11e-36nuclear factor Y, subunit A4
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]