Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g08820.2
Common NameGL2-1, LOC4344832, Os08g0187500, P0020B10.22, P0547A06.49, ROC1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 785aa    MW: 84615.4 Da    PI: 5.5932
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g08820.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
                       688999************************************************995 PP

             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       ela +a++elv++a+++ep+W++ss      ++++e+ + f+++ +      ++ea+r  +vv+m++ +lve+l+d++ q+ + +     +a+
                       57899********************99999999********99888999*****************************.88888888888*** PP

             START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                       t+ev+s+g      galq+m++e+q++splvp R+++fvRy++  ++g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+skvtw
                       **************************************************************99....79999******************** PP

             START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       vehv+++++++h+++++lv+sgla+gak+wv tl+rqce+
                       **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.07104164IPR001356Homeobox domain
SMARTSM003892.3E-20105168IPR001356Homeobox domain
CDDcd000861.35E-19106165No hitNo description
PfamPF000466.4E-18107162IPR001356Homeobox domain
PROSITE patternPS000270139162IPR017970Homeobox, conserved site
PROSITE profilePS5084839.771290522IPR002913START domain
SuperFamilySSF559615.92E-35291521No hitNo description
CDDcd088754.63E-122294518No hitNo description
SMARTSM002349.9E-61299519IPR002913START domain
PfamPF018528.8E-54300519IPR002913START domain
Gene3DG3DSA:3.30.530.207.4E-7365518IPR023393START-like domain
SuperFamilySSF559614.03E-24541774No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.119880.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasQ6ZAR0-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specifically expressed in the L1-layer of the meristem and protoderm (epidermis) of leaf primordia. During leaf development, expressed in protoderm from plastochron 1 (P1) to P4 and down-regulated at P5 to then disappear. Expressed in the epidermis of primary rachis branch, and in the protoderm of secondary rachis branch primordia. Expressed similarly in L1-layer or protoderm in young and developed floral shoots. During embryogenesis, expressed in the outermost (epidermal) cells 2 days after pollination (DAP) and later at 4 DAP in protodermal cells without any organ differentiation. In nearly mature embryo, strongly expressed in protoderm in the shoot apical meristem (SAM) and lateral organ primordia. {ECO:0000269|PubMed:11846882}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis. {ECO:0000269|PubMed:11846882}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Phenotype -- Mutation ? help Back to Top
Source ID
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0779930.0AB077993.1 Oryza sativa mRNA for Roc1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650023.10.0PREDICTED: homeobox-leucine zipper protein ROC1 isoform X2
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLI1QG770.0I1QG77_ORYGL; Uncharacterized protein
STRINGLOC_Os08g08820.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Ito M, et al.
    Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formation in early rice embryogenesis.
    Plant J., 2002. 29(4): p. 497-507